(data stored in ACNUC7421 zone)

EMBL: CP000271.PE260

CP000271.PE260       Location/Qualifiers
FT   CDS_pept        298103..300427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2767"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2767"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33228"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RR1"
FT                   /protein_id="ABE33228.1"
FT                   /translation="MSTDADTITDEQIAAIADRMVEEGRRVSPVTIWKEVRGGSLVAIV
FT                   AALQRWREARQGETPALQVQPGLPEGLAETVMSAADRIWSASQHDAERAFSQRLAAVNQ
FT                   DLEAAVAERDEALAEYQKMIDEVETGRQRVIALTDTLSASESIALRLEAELATVTGRAE
FT                   AAETHVEELAQRASAQDADLEAMKASLDKERLAREESATALASKNDEVAQLTQERDQAR
FT                   HEIVTLSDVCHARTEEVTQWSQEARAASSRAELAEARIEELVQRAAVDHANLEAMNASL
FT                   EAERKAREELAAVVSSKTDELTRVVQEREQALQQVTTLDAACRANAQEVTRWSQEANAA
FT                   TSRAQAAEARIEELVQRVSSQDAGLEAAKASLEEERKGHEELAAVVSGKTDELTRVTQE
FT                   RDQALQQVTTLDAACQANAQEVTRWSQEANAATSRAQAAEVRIEELLQHATSQAAEQQA
FT                   TVALLDEERKARAELATAISGKSDELAQAAQERDQAQQQIVTLSDAHQAKSEEAIRLST
FT                   ELGAALSHAKAAEVQASGSLAKLAALEAELEQARAALAAEREAAAARADQMSVHLNDLQ
FT                   RVTQELEETRQQIATMNEAKAAASADLARVSQDASAAKERAEAAEQQVVQLEQRLAAQA
FT                   AAIAQQNQRAQQASVRADEAERAEEVAALQRQIAAQARANAKALSELRATAEQWVAHAK
FT                   DLKQRLGLASERILFIDARSTGEVALVRRLSSELERLKPDHELIARETQQKLIGATMSH
FT                   QLAQKGYRYDPATAVMSKVTA"
     atgtccacgg acgcagacac aatcaccgat gaacagatcg ctgcaatcgc cgatcgcatg        60
     gtcgaagaag gcagaagagt ttcgccagtg acaatctgga aagaggttcg cggcggttcg       120
     ctggtggcga tagtcgcggc cctgcaacgc tggcgcgaag cgcggcaagg cgaaacgcct       180
     gcattgcagg tccagcccgg cttgccggag ggtctggccg aaaccgtgat gagcgcggcg       240
     gacaggatct ggtccgcatc ccaacacgat gcggagcggg cattcagtca gcgtctggcc       300
     gcagtgaacc aggatctcga agcggccgtc gcggaacggg acgaagcgct tgccgagtat       360
     cagaagatga tcgatgaagt cgaaacggga cgccagcggg tcatcgcgct gacggacacg       420
     ctgagcgcct cggaaagtat tgccctgcgc ctcgaagcgg aactcgcgac cgtcacgggc       480
     cgggccgagg cggccgagac gcacgtcgag gaactcgcgc agcgtgcgtc ggcacaagac       540
     gcggatctgg aagccatgaa ggcttcgctc gacaaggaac gtctggcgcg cgaagagtcg       600
     gccacggctc tcgcgagcaa gaatgatgaa gtcgctcaac tcactcagga acgcgatcag       660
     gcgcggcacg agatcgtaac gttgagcgat gtctgccacg ccagaacaga ggaagtcacg       720
     caatggtcgc aagaagcacg cgcggcctcg tcgcgtgccg agctggcgga ggcgcgcatc       780
     gaggagctcg tgcagcgtgc ggcggtggac catgccaatc tggaagcgat gaacgcatcg       840
     ctcgaagcag aacgcaaggc ccgtgaagag ttggcggcgg ttgtttcgag caagaccgac       900
     gaactgacgc gcgtcgttca ggaacgcgaa caggcgctgc agcaagtcac gacattggac       960
     gccgcctgtc gggcgaacgc gcaggaagtg acgcgatggt cgcaggaagc gaacgctgca      1020
     acgtcacgcg cgcaagcagc cgaggcgcgc atagaagaac tcgtgcaacg tgtgtcgtcg      1080
     caagatgccg gcctcgaagc ggcgaaggcg tcgcttgaag aggaacgcaa gggtcatgaa      1140
     gagttggcgg cggttgtttc gggcaagacc gacgaactga cgcgtgttac tcaggagcgc      1200
     gatcaggcgc tgcagcaagt cacgacattg gacgccgcct gtcaggcgaa cgcgcaggaa      1260
     gtgacgcgat ggtcgcagga agcgaatgcg gccacgtcac gcgcgcaagc agccgaggtg      1320
     cgtatagaag aactcctgca gcatgcgacg tcgcaagctg ccgagcagca agccaccgtc      1380
     gcattgctgg acgaagagcg caaggcacga gcggagttgg ccacagctat atcaggcaag      1440
     agcgatgaat tagcgcaagc cgctcaggaa cgcgatcagg cgcagcagca gattgttacc      1500
     ctgagcgacg ctcatcaagc gaaatcggaa gaagcgataa ggttgtcgac ggagctaggt      1560
     gcagccttgt cgcacgcgaa agccgccgag gtccaggcta gcgggagcct cgcgaaactc      1620
     gcggcgctgg aggctgaact ggagcaagcg cgcgctgcgc tcgcagcgga gcgcgaagcg      1680
     gccgccgcgc gggccgacca aatgtcggtt catctcaacg acctgcagcg cgttactcag      1740
     gaactggaag agacgcgtca gcagatcgcg accatgaacg aggcgaaggc ggccgcgagc      1800
     gccgatctgg ctcgggtgtc gcaggacgcg tcggcggcga aggagcgcgc ggaggccgcc      1860
     gaacagcagg ttgtgcagtt ggaacagcgt ctcgcggcgc aagccgcagc catcgcgcag      1920
     cagaatcagc gtgctcagca ggccagcgtt cgagccgacg aggctgagcg cgcggaggaa      1980
     gtcgccgcgt tgcaacggca gatagcggca caagccaggg ccaacgcaaa agccctcagc      2040
     gagcttcgcg ctactgccga acagtgggtc gcgcatgcca aggacctcaa gcagcggctc      2100
     ggtctggcaa gcgagcggat cctgttcatc gacgcacgca gcaccggcga ggtggcgctc      2160
     gtcaggcggc tttcatccga actggagcgg ctcaagccgg atcacgagct gatcgccaga      2220
     gagacacagc aaaaactgat cggcgcgacg atgagccacc agctcgcgca gaaaggctat      2280
     cgctatgatc cggctacggc ggtgatgtcg aaggtcacgg cctga                      2325
//

If you have problems or comments...

PBIL Back to PBIL home page