(data stored in ACNUC7421 zone)

EMBL: CP000271.PE261

CP000271.PE261       Location/Qualifiers
FT   CDS_pept        complement(300508..301533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2766"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2766"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33229"
FT                   /db_xref="GOA:Q13RR0"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RR0"
FT                   /protein_id="ABE33229.1"
FT                   /translation="MNLKQLTLILCALCASAAHAADITGAGSTFAAPIYTKWADAYQKT
FT                   GGGKVNYQGIGSSGGIKQILAKTVDFAGSDAPLKDDELAKDGLFQFPTVVGGVVPAINV
FT                   PGLKAGELVLSGEVLGDIYLGKIKKWNDPQIAALNPKIKLPDTDIAVVRRADGSGTSFI
FT                   WTNYLSKVNPEWKSKVGEGATVNWPTGTGGKGNDGVAAFVQRLPGAIGYVEWAYAKQNH
FT                   MTYASMKNASGTIVEPTTDTFKAAAAGADWSKSFYQILTNEPGKNAWPVVGATFVLLYT
FT                   TQDKAAQGAETLKFFDWAFRNGGKAADDLDYISLPESVTAEIRAQWKQKVKDASGKPVA
FT                   P"
     atgaatctca agcaacttac gctgattcta tgtgcgttgt gtgccagcgc cgcgcacgcc        60
     gcagacatca ccggcgcggg cagcaccttt gccgcgccga tttacacgaa gtgggccgac       120
     gcctatcaga aaacgggcgg cggcaaagtc aattatcagg gtattggttc gtcgggcggc       180
     atcaagcaga tcctcgccaa gacggtggac ttcgccggct cggacgcccc gctgaaagac       240
     gacgaattag ccaaagacgg cctgttccag tttcccacgg tggttggcgg cgtggtgcct       300
     gccatcaacg tgccgggact gaaggcgggc gaactggtgc tgtcgggtga agtactcggc       360
     gacatctatc tgggcaagat caagaagtgg aacgatcccc agatagccgc gttgaacccg       420
     aagatcaagt tgccggatac ggacattgcc gtggttcgcc gtgccgatgg ttcgggtacg       480
     agcttcatct ggacgaacta cctgtccaag gtgaatccgg agtggaaatc caaagtgggc       540
     gaaggcgcga cggtgaactg gcctaccggc actggcggca agggtaacga cggcgtcgcc       600
     gcattcgttc agcgcctgcc gggcgcgata ggctatgtcg aatgggcgta tgcgaagcag       660
     aaccacatga cctacgcctc gatgaaaaat gcttcgggca ccatagtcga gccgacaacc       720
     gacaccttca aggccgcagc ggcgggcgcc gactggtcga agtcgttcta tcagatcctg       780
     acgaacgagc cgggcaagaa cgcgtggccc gtggtcggcg caacattcgt gctgctgtat       840
     acgacgcagg acaaagcagc gcaaggcgcc gaaacgctga agttcttcga ttgggcgttc       900
     aggaacggcg gcaaggcagc cgacgatctc gactatattt cgctgccgga atcggtaacg       960
     gctgaaatcc gcgcgcagtg gaagcagaag gtgaaggacg cgtcgggcaa gccggtcgcg      1020
     ccataa                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page