(data stored in SCRATCH zone)

EMBL: CP000271.PE262

CP000271.PE262       Location/Qualifiers
FT   CDS_pept        301843..302880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2765"
FT                   /product="Mg2+ transporter protein, CorA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2765"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33230"
FT                   /db_xref="GOA:Q13RQ9"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RQ9"
FT                   /protein_id="ABE33230.1"
FT                   /translation="MKSDLLLQTYGADSSGMVCGFLFSSMRAGRPVDADEVVEWLQAHD
FT                   ANGPPKESSEFLWLHFNLAHSASERWMRTQLDLPETFFDALREGSHSTRIEHADGALRA
FT                   VVNDVMFNLEFIPSEIATLWIYANQRIIVTARLKPLRSVDRLRASVRQGEVFRSPAELL
FT                   VHLMRDQADLLVQIVRRTSADVDRIEDRFLSQRPTQNRIDLGAMRRMLTRLQRMLAPEP
FT                   GAIFRLLARPPRWLHSEDVQDLRESTEEFSVVLSDVAGLIERVRLLQEEIISRLEEQNN
FT                   RTLFTLTLVTVLAMPINIVAGFFGMNVGGIPLAENRHGFWVMVLLVAGFTGLAGWWAFR
FT                   RRKER"
     atgaaatctg acctgctact gcaaacctac ggcgcggact cgtccggcat ggtctgtggc        60
     tttctctttt cgtcgatgcg cgccgggcgg cctgtcgatg cggatgaagt cgtggaatgg       120
     ctgcaggcgc acgacgcgaa tggcccgccg aaggaaagta gcgagttcct ctggcttcac       180
     ttcaatctgg cgcacagtgc cagcgaacgt tggatgagga cacaactgga tttgcctgag       240
     actttcttcg acgccttgcg cgagggctcg cactcgacgc gtatcgaaca tgcggacggc       300
     gcgttgcgcg cggtcgtgaa cgacgtcatg ttcaatctcg agtttattcc ctccgagatc       360
     gcgaccctgt ggatttacgc gaatcagcgg atcatcgtga ccgcgcgcct caagccactg       420
     cgttcggtcg accgattgcg cgcatcggtt cggcaaggag aggtattcag gtctcccgcg       480
     gaattgctgg ttcacctgat gcgcgaccag gccgacctgc tcgtgcagat cgtccggcgc       540
     accagcgccg acgtcgaccg gatcgaggat cgattcctgt cgcagcggcc gacgcagaac       600
     cggatcgatc tgggcgccat gcgtcgtatg ctgacgcgct tgcaacgcat gctcgcgcct       660
     gaacccggcg cgatcttccg gctgctggcg aggccgccgc gctggcttca ctcagaggac       720
     gtacaggatc tgcgcgagtc gacggaagag ttttctgtgg ttctctcgga tgtcgccggg       780
     ttgatcgaac gggtcaggct gctgcaggag gagatcattt cgcggctgga agagcagaac       840
     aatcgcacgc tgttcacgct gacactggtc acggttctgg ctatgccgat caatatcgtg       900
     gcgggctttt tcggcatgaa tgtgggcggt attccgctcg ctgaaaaccg gcacggtttc       960
     tgggtgatgg tgttgctcgt ggccggcttc acgggactgg ccggatggtg ggcgtttcgc      1020
     cggcgcaagg aacggtag                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page