(data stored in SCRATCH zone)

EMBL: CP000271.PE263

CP000271.PE263       Location/Qualifiers
FT   CDS_pept        complement(302949..303875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2764"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2764"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33231"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RQ8"
FT                   /protein_id="ABE33231.1"
FT                   /translation="MRDVASTQERTSDNAGRRTSTVSANMSPAAAFSTLVTPMVATVAQ
FT                   RVGTLCVSADPESLHKLRVVLRRLRSLWWAYDPLIDGSQARRQRREFKALADSAGQTRD
FT                   WDILKHLLADDAQMPHSFAALIERVDLLRGDALLHSRTTIAAANVEALLAQGIADVMLQ
FT                   LEARPFDEPLVGFAADRIATAKKALRKRMKRLLRDQHAGYAEFHEVRIAAKKVRYLLEF
FT                   FAPLIDSGNGIGIVELTQMQDELGKLNDIVSSESLLLVHKDRLGECGMVDDAIAYLRYL
FT                   KGHHMQSADASLRAVGDMLASEHSGSD"
     atgcgtgacg tcgcctctac acaggagcgg acttcggaca atgccggcag acgcaccagc        60
     acggtttcgg ccaacatgtc gccggctgcg gccttctcga cactggtcac gccaatggtc       120
     gcgacggtgg cgcaacgcgt cggcacactg tgcgtgagcg ccgatccgga aagccttcac       180
     aagcttcgcg tggtgctgcg tcgtctgcgc tcgctatggt gggcttacga tccgctgatc       240
     gacggatcgc aggcaagacg gcagcgacgc gaattcaagg ccctggctga ctcggccggc       300
     cagacacgtg actgggatat cctgaagcac ttactggcgg atgacgcgca gatgccgcac       360
     tcttttgcgg cgctcatcga acgtgtggat ctgctgcgcg gcgacgcgct tctgcacagt       420
     cgcacaacaa tagccgccgc gaacgtcgaa gccctattgg cgcagggaat cgcggacgtg       480
     atgctgcaac tggaggcccg cccgtttgac gaaccgcttg tgggattcgc cgcggaccgt       540
     atcgcaacgg cgaagaaagc gctgcgaaaa cggatgaagc ggctgctcag ggatcagcac       600
     gccggatacg ccgagtttca cgaagtccgg atcgcggcga agaaggtgcg ttatctgctg       660
     gagttcttcg cgcctctgat cgatagcgga aatggaatcg gcatcgtcga gctcacgcaa       720
     atgcaggatg agttgggaaa actcaacgac atcgtttcga gcgaatcgct acttctggtg       780
     cataaggatc ggctcggtga gtgcggcatg gtagacgatg cgatcgcgta tctgaggtac       840
     ctcaaaggcc atcacatgca aagcgccgac gcctcgttgc gagctgtcgg cgatatgctg       900
     gccagcgagc attccggctc tgactga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page