(data stored in SCRATCH zone)

EMBL: CP000271.PE265

CP000271.PE265       Location/Qualifiers
FT   CDS_pept        305732..306766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2762"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2762"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33233"
FT                   /db_xref="GOA:Q13RQ6"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RQ6"
FT                   /protein_id="ABE33233.1"
FT                   /translation="MSYTQTLLTGVVGALLAVTAHGADIAGAGSTFAAPIYTKWAGAYQ
FT                   QAGGGAVSYRAVGSTEGVKEIMESQVDFAGSDAPLSDDELARNGLLQFPMVIGGVVPVV
FT                   NLPGIKPGELILSGRVLADIYLGKIINWDAPAIAAINPRIKLPDTPIAVVRRLDGSGTT
FT                   LIWTHYLAQANSEWKSRIGEGTSVRWPRGIGGRGNEGVATFVQHLPGAIGYVAWDFTKQ
FT                   NHMSYTAMENASGAVVQPGPETFKAAAASADWSRSLFPILTNEPGANAWPVVGATYVLL
FT                   HSTQNKPERGEATLKFLEWALTNGDQAAEDLDYVPLPPPVVSEIRTQLHARVKNPSGKA
FT                   IAGE"
     gtgagctata cacaaacact gttgaccggt gtggtcggcg ctctattggc ggtcacggcg        60
     cacggcgccg acattgccgg cgccggcagc accttcgccg cgccgattta tacgaaatgg       120
     gccggcgcat accagcaggc aggcggcggc gcggtgagct atcgcgctgt cgggtcgacc       180
     gaaggcgtga aggaaatcat ggagagccag gtcgatttcg ccgggtcgga cgcgccgttg       240
     agcgacgacg aacttgccag gaacggcttg ctccagtttc caatggtgat cggcggggtc       300
     gtgccggtcg tcaatctgcc cggtatcaag cccggtgagt tgattctctc cgggcgtgtg       360
     ctcgcggata tctacctggg caaaatcatc aactgggacg cgccggccat tgccgccatc       420
     aatcccagga tcaagctgcc ggatacgcct atcgccgttg tccgccgcct tgacggttcc       480
     ggtaccacgc tgatctggac gcactatctc gcgcaggcca attctgaatg gaagagccgg       540
     atcggcgaag ggacttcggt gcgctggcca cgcggtatag gcggaagagg taatgaaggg       600
     gtggccactt tcgtccagca tttgccaggt gcgatcggct acgttgcgtg ggatttcacg       660
     aagcagaacc atatgtcgta cacggcgatg gaaaatgcct cgggtgccgt ggttcagcct       720
     ggaccggaga cattcaaggc ggccgccgcg agcgcggact ggtccagatc tcttttccca       780
     atcctgacca atgagccggg cgcgaacgcg tggcctgtgg tcggtgcgac atatgtactg       840
     cttcacagta cgcagaacaa accggagcgc ggcgaggcga cactgaagtt cctggagtgg       900
     gcgctgacca acggcgacca ggctgcggag gatctggact atgtgccgct gccgccgccg       960
     gtggtgagcg aaattcgcac gcagttgcat gcgcgggtga agaatccgtc gggtaaggca      1020
     attgccggcg aatga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page