(data stored in ACNUC7421 zone)

EMBL: CP000271.PE266

CP000271.PE266       Location/Qualifiers
FT   CDS_pept        complement(306816..307247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2761"
FT                   /product="Putative PAS/PAC sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2761"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33234"
FT                   /db_xref="GOA:Q13RQ5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RQ5"
FT                   /protein_id="ABE33234.1"
FT                   /translation="MQNAIDFQQLANAIGDAIIISDSQGSITFWNPAAERMFGFTQDEA
FT                   LGNSLDLIIPERLRGRHWDGYHKTMTTGETRYGNDVLRVPSVHKDGRSMSIAFTVALLH
FT                   SPDNELTGIVAVIRDETSRFQEDRLLRKRLAELEASAGA"
     atgcaaaatg cgatcgactt ccagcaactt gccaacgcaa tcggcgacgc gatcatcatt        60
     tcggattccc agggcagcat cacattctgg aaccccgcgg ccgagcgcat gttcggcttt       120
     acgcaagacg aggcgctcgg caattcgctg gacctgatca ttccggagcg gctgcgcggc       180
     cgccattggg acggctatca caagaccatg acaaccggcg aaacccgcta cggcaacgat       240
     gtgctgcgtg ttccctccgt gcataaggac gggcggtcca tgtcgattgc cttcacggtg       300
     gcgttgctgc attcgccgga caatgaactc accggtatcg tcgccgtgat ccgcgacgaa       360
     accagccgct ttcaggaaga tcgcctgctg cgcaaacggc ttgcggaact ggaggcgtcc       420
     gccggcgctt ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page