(data stored in SCRATCH zone)

EMBL: CP000271.PE270

CP000271.PE270       Location/Qualifiers
FT   CDS_pept        312153..312590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2757"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2757"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33238"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RQ1"
FT                   /protein_id="ABE33238.1"
FT                   /translation="MRASILGRATCLKEMTMNHAQLNAGDSVHDAEIDAQLCAYNAAFD
FT                   ELGLRFRWDAQTLTSLAVIDGERAQIAAYIESHHPHLLKAYSAEFLSQAILDRKSARYP
FT                   APLPRRVGSASLSTHAVRQSGTSSRRERVSYDIELPALAGV"
     atgcgcgctt ctattcttgg tcgtgccacc tgtctgaagg agatgaccat gaatcacgcc        60
     caactcaacg ctggcgacag cgtgcatgat gctgagatcg acgcacaact atgcgcatac       120
     aacgccgcgt tcgacgaact cggcttgcgg tttcgctggg atgcccagac gctgacgtcg       180
     ctggccgtga tcgacggcga acgggcacag atcgccgcgt atatcgaatc gcaccacccg       240
     catctgctga aggcctatag cgccgagttt ctgagccagg ccattctgga caggaaaagc       300
     gcgcgttatc cggcgccttt gccacgacgt gtcggtagtg cgtcgctctc gacacacgcg       360
     gtacgtcagt cggggacgag tagccggcgc gagcgcgttt cgtacgacat agaactgccg       420
     gcactggcgg gcgtgtag                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page