(data stored in ACNUC7421 zone)

EMBL: CP000271.PE271

CP000271.PE271       Location/Qualifiers
FT   CDS_pept        complement(312752..313102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2756"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2756"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33239"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RQ0"
FT                   /protein_id="ABE33239.1"
FT                   /translation="MKKALVYLVLAASALSAPVFAFAQSNGPVTRAEVRSDLVKLEQAG
FT                   YNPAQGNDANYPTDIQAAEAKVAAQTSQQLATQGYGGVTQNGSSSSGGPARVAMHSTCV
FT                   GPVSFCTPYFGS"
     atgaaaaaag ctcttgtcta tctcgtcctc gccgcaagcg cgttgtccgc tccggtgttc        60
     gcgttcgcac aatcgaatgg tccggtaacg cgcgcggaag ttcgcagcga tctggtcaag       120
     ctcgaacagg caggctataa cccggcccaa ggcaacgacg ccaactatcc gaccgacatc       180
     caggctgcgg aggcgaaggt agccgcacaa accagtcaac aactggctac gcaaggctat       240
     ggcggcgtga cgcaaaacgg cagttcgtcg tcaggcggac cggcacgtgt ggcgatgcat       300
     tcgacttgcg tcggtccggt cagcttctgc acgccgtact tcggcagctg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page