(data stored in ACNUC7421 zone)

EMBL: CP000271.PE272

CP000271.PE272       Location/Qualifiers
FT   CDS_pept        complement(313326..313913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2755"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2755"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33240"
FT                   /db_xref="GOA:Q13RP9"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RP9"
FT                   /protein_id="ABE33240.1"
FT                   /translation="MEERIKHLLNQISVLESELQAELHQREVKLFYRITGKHVEFDKAV
FT                   GKAHRELKVGIVRWILSSRPQNFLAAPFVYGLVFPLVFLDLCISIYQAICFPIYGIAKV
FT                   KRADYIVMDRWQLHYLNFMERFHCAYCEYANGLIAYASEIAARTEQYWCPIKHARKVLG
FT                   THARYERFLAYGEAEQYQERLAQFRDALRKQQ"
     gtggaagagc ggataaagca tctcctgaat cagatcagcg tgctcgagtc ggaactgcaa        60
     gcggaacttc atcaacggga agtcaaactg ttctatcgaa tcaccggcaa acatgtcgaa       120
     ttcgacaaag cggtcggcaa ggctcatcgg gaattgaaag tgggcatcgt ccgctggatt       180
     ctctccagcc ggccgcaaaa tttcctggcg gcgccgttcg tctacgggct cgttttcccc       240
     ttggtatttc tggatctttg catctccatc tatcaggcaa tctgtttccc gatctacggc       300
     atcgcaaagg tcaagcgggc ggactatatc gtgatggacc gctggcaact gcactatctc       360
     aacttcatgg agcgattcca ttgcgcatat tgtgaatatg cgaatggcct catcgcatac       420
     gcgtcggaaa ttgccgcgcg cacggaacag tattggtgtc ctatcaaaca cgctcgcaag       480
     gtgttaggca cgcatgcaag gtatgaacga tttttggctt atggcgaagc ggagcagtat       540
     caggagcgtc tcgcgcagtt tcgcgatgca ctgcgcaagc agcaatag                    588
//

If you have problems or comments...

PBIL Back to PBIL home page