(data stored in ACNUC7421 zone)

EMBL: CP000271.PE273

CP000271.PE273       Location/Qualifiers
FT   CDS_pept        complement(313997..314266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2754"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2754"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33241"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RP8"
FT                   /protein_id="ABE33241.1"
FT                   /translation="MKRIFPALLIALATVGTTQVWAQNTAPSGADGAQPGDNIVQMRSE
FT                   IRAANEAYRARVRAANKARDREVAKAQADRVKAVQAAQSGGSGG"
     atgaaaagga ttttcccagc cctcctgatt gcgctggcaa cagtcggcac gacccaggtt        60
     tgggcccaga ataccgcacc gtccggcgca gacggcgctc aacccggcga caacatcgtg       120
     cagatgcgaa gcgagatccg cgccgcgaat gaggcttacc gcgcgagggt acgcgcggca       180
     aacaaggctc gcgaccgcga ggtcgccaaa gcgcaggccg atcgggtcaa ggccgtccag       240
     gcggcacagt ctggtggaag cggcggttga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page