(data stored in ACNUC7421 zone)

EMBL: CP000271.PE275

CP000271.PE275       Location/Qualifiers
FT   CDS_pept        315530..316786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2752"
FT                   /product="terephthalate 1,2-dioxygenase, alpha subunit"
FT                   /function="Rieske-type bacterial ring
FT                   hydroxylatingdioxygenase, alpha subunit"
FT                   /note="Citation: FEMS Microbiol. Lett. 220 (2), 255-
FT                   260(2003); Terephthalate degradation"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2752"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33243"
FT                   /db_xref="GOA:Q13RP6"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RP6"
FT                   /protein_id="ABE33243.1"
FT                   /translation="MRARRASITWPSEGLTRVPYALFQDEGVYADEQDAIFRGPNWSYL
FT                   CLEAEVPNQGDFRSTFVGDAPVVVTRDTDGEIYAFENRCAHRGAMVCLEDQGNARDFSC
FT                   VYHAWTYSLQGDLVGVAFKDGIDGKGGMKPDFCTGDHGLRKLRVATLHGLVFGSFSDDV
FT                   PPLDEYLGEEIVERIARVLENRKPVVLGRFTQMLPNNWKLYFENVKDSYHASILHLFFT
FT                   TFQLNRLSQRGGIIVDPSGGHHVSYSAVDHAAEAAAQRKATSDYADQKIRSESEHRLED
FT                   TSVLAGVDEFGDGVTLQILSVFPGFVLQQIQNAIAVRQILPRGTQQTELNWTYLGFEDD
FT                   TPELREMRLRQSNLVGPAGYVSMEDGCVGGFVQRGIEGAGDGRSVIEMGGDSAESSASR
FT                   VTEASIRGFWKAYRNAMGY"
     atgcgggcgc ggcgcgccag catcacctgg ccgtccgagg gcctgacgcg cgtgccctac        60
     gcgctgtttc aggacgaagg cgtgtacgcc gacgaacagg acgcgatctt ccgcggcccg       120
     aactggagct acctgtgcct tgaagctgaa gtgccgaatc agggcgactt tcgcagcact       180
     ttcgtaggcg acgccccggt ggtcgtcacg cgcgacaccg acggcgaaat ctatgcgttc       240
     gagaatcgct gcgcgcatcg cggcgcgatg gtctgcctcg aagaccaggg caatgccaga       300
     gatttcagtt gcgtctatca cgcatggacc tacagcctgc aaggcgatct ggtaggcgtc       360
     gcgttcaagg acggcattga cggcaagggc ggcatgaagc cggatttctg caccggcgat       420
     cacggattgc gcaagctgcg tgtcgcgacg ctgcatggcc tcgtgttcgg cagcttttcc       480
     gacgacgtcc cgccgctcga cgagtacctc ggcgaagaaa tcgtcgaacg tatcgcgcgc       540
     gtgctggaga accgcaagcc ggtcgtgctc gggcgattca cgcaaatgct gccgaacaac       600
     tggaagctct acttcgagaa cgtcaaggac tcctaccacg ccagcattct gcatctgttt       660
     ttcacgacgt ttcagctgaa ccgcctgtcg cagcgcggcg gcatcatcgt cgatccgagc       720
     ggtggtcatc acgtgagcta ctcggctgtc gaccatgccg ctgaagccgc ggcacaacgg       780
     aaagccacca gcgactacgc ggatcagaaa atccgttcgg aaagcgagca tcgtctcgaa       840
     gacacttccg tgctcgccgg cgtggacgag ttcggggacg gcgtcacgct gcagattctt       900
     tcggtgtttc ccggcttcgt gctccagcag atccagaacg cgatcgcggt ccgccagatt       960
     ctgccgcgcg ggacgcagca aaccgaattg aactggacct acctcggctt cgaagacgac      1020
     acaccggaat tgcgcgaaat gcgcctgcgc cagtcgaacc tggtcggacc cgcgggttac      1080
     gtgtcgatgg aagacggatg cgtcggcggc ttcgtgcaac gcggcatcga aggcgcgggc      1140
     gacggccgct ccgtgatcga aatgggcggc gatagcgccg aaagcagcgc gagccgggtg      1200
     acggaagcgt cgattcgcgg cttctggaaa gcctaccgca acgcaatggg atactga         1257
//

If you have problems or comments...

PBIL Back to PBIL home page