(data stored in SCRATCH zone)

EMBL: CP000271.PE276

CP000271.PE276       Location/Qualifiers
FT   CDS_pept        316789..317259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2751"
FT                   /product="terephthalate 1,2-dioxygenase, beta subunit"
FT                   /EC_number="1.14.12.15"
FT                   /note="Terephthalate degradation; Citation: Environ. Health
FT                   Perspect. 103, 9-12(1995)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2751"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33244"
FT                   /db_xref="GOA:Q13RP5"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RP5"
FT                   /protein_id="ABE33244.1"
FT                   /translation="MAQDIYQLIARAQADYVRCIDDGDLAQWPDFFTDACVYRVTTADN
FT                   YRRGLTGSMIYAASRGMLVDRIASLRGANIYERHSYRHLLGQPSVISAAEREARSETSF
FT                   MVARIMRDGSTSLFATGRYCDVYAVEENGVRLRERIVVCDSSRIDTLLALPL"
     atggcgcaag acatctatca actgattgcc cgcgcgcagg ccgactacgt gcgctgcatc        60
     gacgacggcg atctcgcgca atggccggac ttcttcaccg atgcgtgcgt ctacagggtg       120
     acgaccgccg acaattacag gcgcggcctc acgggcagca tgatctatgc ggcttcgcgc       180
     ggcatgctgg tcgaccggat tgcctcgctg cgcggcgcca acatttacga acgccacagt       240
     tatcggcatc tgctcgggca gcccagcgtc atcagcgcgg cagagcggga ggctcgcagc       300
     gagacctcgt tcatggtggc gcggatcatg cgcgacggct cgaccagcct gttcgccacc       360
     ggccgctatt gcgacgtgta cgccgtggag gagaacggcg tgaggctgcg tgaacggatc       420
     gtggtgtgcg acagctcgcg catcgacacg ttgctggcgt tgccgctatg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page