(data stored in ACNUC7421 zone)

EMBL: CP000271.PE283

CP000271.PE283       Location/Qualifiers
FT   CDS_pept        complement(324317..325063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2744"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2744"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33251"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RN8"
FT                   /protein_id="ABE33251.1"
FT                   /translation="MAAITSPRQHRMPDTLTSYFWSGDAIRSRRVSDIVLSGSLDVPVP
FT                   PLRLLADWEREISSHMVLEAGDVEPMPLARARARWPDYSRCVQAVSDWMCALGLPGVLA
FT                   SSDVALMACRGARYHHDAAQYGSAAFCNLFMSEDKGLDLHFPALGHRIPLTRGTVVIFD
FT                   TAQPHGVIQRGSSGFDAADFAPGQDCIQIFLTWELPIEDAHVAHALEVAFDTAPSTSSQ
FT                   LDAEQVQLNGEQVIVCPASGRWRPSD"
     atggccgcca tcacttcccc tcgacagcac cgaatgccgg acaccctgac ttcctatttc        60
     tggagtggcg acgccattcg cagccggcgc gtgagcgata tcgtgctatc aggctcactc       120
     gatgtgcctg tgcctcccct gcgtctgctc gcggattggg aaagggaaat ctcgtcgcac       180
     atggtgctgg aagccggcga cgtcgaacca atgcctctgg cgcgagcacg ggcgcgctgg       240
     ccggactact cgcgctgcgt acaggccgtg tccgactgga tgtgcgcgct cggactgcca       300
     ggcgtgcttg cctccagcga cgtagccctc atggcctgcc gcggcgcgag ataccaccat       360
     gacgccgcac aatacggcag tgcggccttt tgcaatctgt tcatgagcga agacaaggga       420
     ctggacctgc attttcccgc gctgggtcat cgcattccgt tgactcgggg aacggttgtg       480
     atattcgata ccgcgcagcc gcacggcgta attcagcgcg gcagcagcgg atttgatgcg       540
     gccgacttcg cacccggtca ggattgcatc cagatattcc tgacctggga gcttcccatc       600
     gaagatgccc atgttgcgca tgcactcgaa gtcgcgttcg acaccgcccc ttcgacctcg       660
     tcgcaactcg acgcagagca agtccagctg aacggcgaac aggtcattgt gtgcccggct       720
     tccggccgct ggcgcccgag cgactga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page