(data stored in ACNUC7421 zone)

EMBL: CP000271.PE287

CP000271.PE287       Location/Qualifiers
FT   CDS_pept        330601..331788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2740"
FT                   /product="Putative lipid transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2740"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33255"
FT                   /db_xref="GOA:Q13RN4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RN4"
FT                   /protein_id="ABE33255.1"
FT                   /translation="MSEKVLVAGVGMIQFAKPGASQSYTEMGAEATRRALADAGIAYDL
FT                   VQQAFAGYVYGDSTCGQTAIYEVGMTGIPIVNVNNNCSTGSTALYLARQAIATGDADCV
FT                   LALGFEQMQAGALKSHWDDRPVTRARFVPIMHGLTADLAHLPQALRTFGGAGREHMQRY
FT                   GTRMETFAAVRAKASRHAANNPLALFRKQVTTEDVMNDTVLMPGVMTRLMACPPTCGGA
FT                   AAILVSEKFAKKHGLRTGVQIVAQSLTTDPPASFDPPSMLNYVGTHMTRSAANKVYEKA
FT                   GIGPEDIDVCELHDCFAHNEVICYESLGFCPEGGAEKFVSDGDNTYGGKVVVNPSGGLL
FT                   SKGHPLGATGLAQCYELTHQLRGTADQRQVQGAKLALQHNLGLGGACVVTLYGKH"
     atgagcgaaa aagtactggt ggcgggcgtg ggcatgatcc agttcgccaa gcccggcgcg        60
     agccagagct acaccgaaat gggcgccgaa gcgacccgcc gtgcgctggc cgatgcaggc       120
     attgcgtacg acctcgttca gcaggccttc gcaggctacg tctacgggga ctccacgtgc       180
     gggcagaccg cgatctacga agtgggcatg acgggcattc cgatcgtcaa cgtcaataac       240
     aattgctcga cgggttcgac cgcgctctat ctggcacgcc aggcgattgc caccggcgac       300
     gccgactgcg tgctcgcgct cggcttcgag cagatgcagg ccggcgcatt gaaatcgcac       360
     tgggacgacc ggccggtaac gcgtgcgcgc ttcgtaccga tcatgcacgg cctgaccgcc       420
     gacctcgcgc atctgccgca ggcgctgcgc acgttcggcg gcgcggggcg cgaacacatg       480
     cagcgctacg gcacgcgcat ggaaaccttt gccgcggtgc gggccaaggc gagccgccac       540
     gcggcgaaca atccgctggc gctgttccgc aaacaggtca cgaccgaaga cgtgatgaac       600
     gacacggtgc tgatgcccgg cgtgatgacg cgtctgatgg cctgtccgcc gacttgcggc       660
     ggcgcggcgg cgatcctcgt ctccgagaag ttcgcgaaga aacacggctt gcgcacgggt       720
     gtgcagatcg ttgcacagtc gctcaccacg gatccgccgg cttcattcga cccgccgtcg       780
     atgctcaact acgtcggcac gcacatgacg cgttcggccg cgaacaaggt ctacgaaaaa       840
     gccggtatcg gaccggaaga catcgacgta tgcgagctgc acgactgttt tgcgcacaac       900
     gaagtcatct gctacgaatc gctcggcttc tgtccggaag gtggcgccga gaagttcgtc       960
     agcgacggtg acaacacgta cggcggcaag gtggtggtca atccgtcggg cggtctgctt      1020
     tccaaggggc atccgttggg cgcgaccggc cttgcgcagt gctatgagct gacccaccag      1080
     ttgcgcggca ccgccgacca gcgtcaggtg caaggcgcga agctggcgct tcagcacaat      1140
     ctcggccttg gcggcgcgtg cgtggtgacg ttgtacggca agcactga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page