(data stored in SCRATCH zone)

EMBL: CP000271.PE295

CP000271.PE295       Location/Qualifiers
FT   CDS_pept        341615..342364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2730"
FT                   /product="Electron transfer flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2730"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33263"
FT                   /db_xref="GOA:Q13RM6"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RM6"
FT                   /protein_id="ABE33263.1"
FT                   /translation="MKVLVAVKRVVDFNVKIRVKSDGSGVELANVKMSINPFDEIAVEE
FT                   AVRLREKGVVSEVIAVSCGTSASQETLRTAMAIGADRGILVETDAELQPLAVAKLLKAL
FT                   VDREKPQLVILGKQAIDNDCNQTGQMLAALAGCAQATFASRVELSNDCATVTREIDGGL
FT                   ETLRLKLPAVVTSDLRLNEPRYATLPNIMKAKKKPLDVVTPEQLGVDVAPRLKALRTIE
FT                   PAGRSAGVKVPDVAALVAKLKNEAKVI"
     atgaaagtat tggtcgcggt aaaacgcgtg gtggacttca acgtcaagat tcgggtcaag        60
     tctgacggct cgggcgtcga gttggcgaac gtcaagatga gcatcaatcc gttcgatgaa       120
     atcgccgtcg aggaagccgt gcgcctgagg gaaaagggcg tggtcagcga agtgatcgca       180
     gtgtcgtgcg gcacgagcgc ttcgcaggaa accttgcgca cggcaatggc gatcggcgcg       240
     gatcgcggca ttctggtcga aacagacgca gagctgcagc cgctcgcggt ggccaagctg       300
     ctgaaggcac tggtcgacag ggagaagccg caactggtga ttctcggcaa gcaggctatc       360
     gacaacgact gcaaccagac cggccagatg ctggcggcgc tcgcgggttg tgcgcaggcc       420
     acgtttgcga gccgggtgga actgtcgaac gattgcgcga ccgtcacgcg tgaaatcgac       480
     ggcggactcg agacgttgcg gctcaagttg ccggcggtcg tcacgagcga tctgcgcctg       540
     aacgagccgc gctatgccac gctgcccaac atcatgaagg cgaagaagaa gccgctggac       600
     gtcgtcacgc cggaacaact gggcgtggat gtcgcgcctc gcctgaaggc gctccgcacg       660
     atagagccgg ctgggcgcag cgcaggcgtg aaggtgcccg acgtcgcggc gctggtcgcg       720
     aagctgaaga acgaagcgaa agtgatctga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page