(data stored in ACNUC7421 zone)

EMBL: CP000271.PE296

CP000271.PE296       Location/Qualifiers
FT   CDS_pept        342375..343319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2729"
FT                   /product="Electron transfer flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2729"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33264"
FT                   /db_xref="GOA:Q13RM5"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RM5"
FT                   /protein_id="ABE33264.1"
FT                   /translation="MTASNQVLVVAEHDQGSIRTATLNTVAAALQCGAEVHMLVAGYDA
FT                   TGAAQAAAAIKGVAFVLHADAPQLADGLAENIAAQVVALAANYGHILFPATSAGKNIAP
FT                   RVAALLDVAQVSDIVRVLSPDTFQRPIYAGNALVTVQSSDPVKVLTVRVTGFDAVAAEG
FT                   GAAQIEAIDTVADSGLSTFVERVVAKSDRPELGDAQIVVSGGRALGSNEKFTEVLTPLA
FT                   DKLGAALGASRAAVDAGFAPNDWQVGQTGKIVAPQLYVACGISGAIQHLAGMKDSKVIV
FT                   AINKDPEAPIFSIADYGLEADLFDAVPQLVNAI"
     atgactgcat ccaatcaagt gctggtcgtg gctgaacacg accagggttc gatcaggacg        60
     gccacgctga acacggttgc cgccgcactg caatgcggcg ccgaggttca tatgctcgta       120
     gccgggtatg acgcaacggg cgcggcccaa gccgcggccg cgatcaaagg cgtggcgttc       180
     gtgctgcacg ccgatgcgcc ccaactcgct gacggccttg ctgaaaacat cgcggcccag       240
     gttgtcgcgc tcgccgcgaa ttacggccat atcctgtttc ccgccaccag tgccggcaag       300
     aacatcgcgc cgcgcgtcgc ggcgctgctc gacgtggcac aggtgtcgga tatcgtgcgg       360
     gtgctgagcc cggacacgtt ccagcgtccc atctacgcgg gcaatgcgtt ggtcacggtg       420
     caaagcagcg atccggtgaa ggtgttgacc gtgcgcgtga cagggttcga tgccgtagcg       480
     gccgaaggcg gcgcggcgca gatcgaagca atcgacacgg tggcggacag cggcctgtcc       540
     accttcgtcg agcgcgtggt cgcgaaaagc gaccggcccg aactcggtga tgcgcagatc       600
     gtggtgagcg gcggtcgtgc gctcggcagc aacgagaagt tcaccgaagt cctcacgccg       660
     ctcgcagaca agctcggtgc ggcgctcggc gcgagccgcg cggcggtcga cgcgggattc       720
     gcgccgaacg actggcaagt cggtcagacg ggcaagatcg tcgcgccgca actgtatgtg       780
     gcgtgcggta tctcgggcgc cattcagcat ctggcgggga tgaaagattc gaaggtcatt       840
     gtggcgatca acaaggatcc ggaggcgccg atcttcagca tcgccgatta cgggctggaa       900
     gccgatctgt tcgatgcggt gccgcaactg gtcaatgcga tctga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page