(data stored in ACNUC7421 zone)

EMBL: CP000271.PE297

CP000271.PE297       Location/Qualifiers
FT   CDS_pept        complement(343725..344549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2728"
FT                   /product="Putative 3-oxoacyl-acyl carrier protein
FT                   reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2728"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33265"
FT                   /db_xref="GOA:Q13RM4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RM4"
FT                   /protein_id="ABE33265.1"
FT                   /translation="MGKLDGKVALVTGSGRGIGRAIAEKLASEGARLVINDLDADPAHE
FT                   TVEALKKMGAEAVACVGNVGAPDFADRFINTAMSTYKGIDIIVNNAGYTWDDVIQKMTD
FT                   EQWYAIIDCHMTAPFRILRAAYPHVKALHAADKEAGRDVYRKIVNISSTSALNGNAGQM
FT                   NYSSAKAGVIGMTRALSREWGRFNVNVNCVAFGLIHTRMTTADAHAGATVKIEGRDIRV
FT                   GLNPELLKTHAQRNPLGRGGTPEEAAGGVYLFCSPESNYITGQTIAVAGNLQ"
     atgggaaagc ttgacggtaa agtagcgctc gtcacgggtt cgggtcgcgg cattggccgc        60
     gcgatcgccg agaagctggc gagcgaaggc gcacgtctcg tgatcaacga cctcgacgcc       120
     gacccggcgc acgaaacggt cgaagcattg aagaagatgg gcgcggaagc cgtggcttgc       180
     gtcggcaacg taggtgcgcc ggacttcgcc gaccgcttca tcaatacggc gatgagcacg       240
     tacaagggca tcgacatcat cgtcaacaat gcgggttaca cgtgggacga cgtgatccag       300
     aagatgaccg acgaacagtg gtacgcgatc atcgactgcc acatgaccgc gccgttccgc       360
     attctgcgcg ccgcctatcc gcatgtgaaa gccctgcacg cggctgacaa ggaagccggc       420
     cgcgacgtgt atcgcaagat cgtcaacatc tcgtcgacgt ccgcgctcaa cggcaacgcg       480
     ggacagatga actactcgtc ggccaaagcc ggcgtgatcg gcatgacgcg cgcgttgagc       540
     cgcgagtggg ggcgcttcaa cgtcaacgtc aattgcgtgg cattcggtct gatccacacc       600
     cgcatgacga cggccgacgc gcatgcaggc gcgaccgtga aaatcgaagg acgcgatatc       660
     cgcgtgggcc ttaatcccga gctgctcaag acgcacgcgc agcgcaatcc gctgggtcgc       720
     ggcggcacgc ctgaagaagc ggccggcggc gtctacctgt tctgctcgcc cgagtcgaac       780
     tacatcaccg gccagaccat cgcggtcgcg ggcaatctgc agtaa                       825
//

If you have problems or comments...

PBIL Back to PBIL home page