(data stored in SCRATCH zone)

EMBL: CP000271.PE299

CP000271.PE299       Location/Qualifiers
FT   CDS_pept        complement(345004..345444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2726"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2726"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33267"
FT                   /db_xref="InterPro:IPR016709"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RM2"
FT                   /protein_id="ABE33267.1"
FT                   /translation="MIDKKHIGKVIPAFRTVAEAGRLRFFAKATGETNPVYFDESAARD
FT                   AGHPTLPLPPTFLFSLELEQPDKSWRDEIGIQVARILHGEQSFTYHKMAYAGDVLLFEC
FT                   RIADIYDKKGGALDFVVRETRVTNQKGEHVADMRSVLVHRNG"
     atgatcgata aaaaacacat cggcaaagtg attcccgcgt ttcgcaccgt ggccgaagcg        60
     ggccggttgc ggttcttcgc caaggcaacc ggcgaaacca acccggttta cttcgacgaa       120
     tccgcggccc gcgacgcggg ccacccgact ctgcccttgc cgcccacctt cctgttctca       180
     ctcgaactgg agcagccgga caaaagctgg cgcgacgaga tcggcattca ggtggcgcgc       240
     atcctgcacg gtgagcaatc gttcacctat cacaagatgg cctacgccgg cgacgtgctg       300
     ctgttcgaat gccgcatcgc cgacatctac gacaagaaag gcggtgcact cgatttcgtg       360
     gtgcgcgaga cgcgcgtgac caatcagaaa ggcgagcatg tggccgacat gcgcagcgtg       420
     ctggtacacc gcaacggctg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page