(data stored in SCRATCH zone)

EMBL: CP000271.PE3

CP000271.PE3         Location/Qualifiers
FT   CDS_pept        complement(2251..3633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3026"
FT                   /product="Putative replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3026"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32971"
FT                   /db_xref="GOA:Q13SG8"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SG8"
FT                   /protein_id="ABE32971.1"
FT                   /translation="MLSPNPSSTRRMATKRAKKTDVVSPSSAELRKAVEAIAIQPKSGK
FT                   ITLLTRKLFNVLLAVAQQADESGDTYRALLSDIVANSAFDSNDTALVKEHLRRMVSVQV
FT                   EWSTGTSSQKPGRKWGISTLIADAEILEDPTTRRVWVEFSFAPKIKKKLLDPVQYARLS
FT                   LQFQSQLRSSAGLALYEICVRYLTNPSHLTMRETWEWWRPILSGTPDTEAGDEAKREYK
FT                   YFKRDYLRPAIAEVNAVTNIFVELIEHREGRRVAEIQFRVTERKQPMLALDEHPNVFDS
FT                   TLVDRMVKIGIPLKEAQTLYADSEENRIRAALQMTEQRMRSTSLPPVRSAPALFKDALK
FT                   KGYAPPVEALPSSGGGKAAVAAPADDLKARLLGEYSAYRRKEARELYDEQGESEREIAR
FT                   QSFEEDELPGLGTHMRDDWRRRGLDSKIVETAFFDWLARKTWGEPTDGDLLAFTLSQSR
FT                   AA"
     atgctctcgc caaatccctc ctcgaccaga cgcatggcca cgaagcgcgc gaagaagacc        60
     gatgtagtca gcccgagctc ggccgaattg cgcaaagccg tcgaggcaat cgcgatccag       120
     ccgaaaagcg gcaaaatcac gctgcttacc cgcaagctgt tcaacgtgct cctcgccgtc       180
     gcccagcaag cggatgaatc cggtgacaca tatcgggccc tgctgtccga catcgtcgcg       240
     aactccgcgt ttgattccaa cgacaccgcg ctcgtcaagg agcacttgcg gcgcatggtt       300
     tcagtgcagg tggaatggag caccggaacg tccagtcaga aaccaggccg gaaatggggc       360
     atttcaacgc tgatcgccga cgcggaaatt ctcgaagatc ccaccacccg tcgcgtctgg       420
     gtggagttct cgtttgcgcc caagatcaag aagaagctgc tcgacccggt tcagtacgcg       480
     cgtctgagtc tccagttcca aagccagctt cgcagtagtg cggggctcgc gctttacgag       540
     atttgcgtgc gctacctgac caacccgagt catctgacga tgcgggaaac gtgggaatgg       600
     tggcgcccta tcctttccgg tacgccggac acggaagcgg gcgacgaggc gaagcgcgag       660
     tacaagtact tcaagcgtga ttacctgcgc ccggccatcg ccgaggtcaa cgctgtcacc       720
     aacatcttcg tcgaactgat cgagcaccgg gaaggacgcc gcgtggccga gatccagttc       780
     cgcgtgaccg agcgcaaaca gcccatgctc gcactcgacg agcatccaaa cgtgttcgac       840
     agcacgctgg tcgaccggat ggtgaagatc ggtatcccgc tgaaagaggc gcaaacgctt       900
     tacgccgata gcgaagaaaa tcgtattcgt gccgcgcttc agatgaccga gcaacgcatg       960
     cgcagcacgt cgttgccgcc ggtgcgcagc gcgcccgcgt tgttcaagga cgccttgaag      1020
     aaaggttatg caccgccggt cgaagcgctg ccgtcgagcg gtggcggcaa ggctgcggtg      1080
     gctgcgccgg cggacgatct caaggccagg ctgcttggcg agtactcggc atatcgccgc      1140
     aaggaagcgc gcgagttgta cgacgaacag ggtgagtccg agcgggagat cgcgcggcag      1200
     tcgtttgaag aagatgagtt gccgggactc ggcactcaca tgcgcgacga ctggcgtcgt      1260
     cgtgggctgg attcgaagat tgtcgaaacg gcattcttcg attggctggc tcgcaagacc      1320
     tggggcgagc caaccgacgg cgatctgctt gccttcacgc tgagccagtc gcgcgcggcg      1380
     taa                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page