(data stored in SCRATCH zone)

EMBL: CP000271.PE300

CP000271.PE300       Location/Qualifiers
FT   CDS_pept        complement(345472..346656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2725"
FT                   /product="Putative nonspecific lipid transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2725"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33268"
FT                   /db_xref="GOA:Q13RM1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RM1"
FT                   /protein_id="ABE33268.1"
FT                   /translation="MTRNVFVAGVGMIPFKKPGTSDPYDVMGAGAVREALIDAGIDYAD
FT                   VQQAYAGYVYGDSTCGQKALYHVGMTGIPIINVNNNCATGSSALFLARQAVQSGAVDCA
FT                   LAVGFEFMQPGALSSKWSDRAPALERALSVVNELVDRTDLPSAIRQFSGAGRAHMEKYG
FT                   TKLETFAKIRAKASQHAARNPLAVFRTVVTPEEVLASPMIWEGVLTRLMACPPTCGAAA
FT                   AIVVSEEFARKRGLRTDVLIAAQSLTTDLPSTYDSRDMIRVVGFDMTRAGAKLAYEQAG
FT                   VGPEDIDVIELHDCFAQNELLTYEGLGLCAEGEAEKLVNDGDNTYGGKWVVNPSGGLLS
FT                   KGHPLGATGLAQCYELTHQLRGTADQRQVEGAKVALAHNLGLGGACVTTVYKAA"
     atgactcgta acgtgttcgt cgccggcgtc ggcatgattc cgttcaagaa gcccggcacc        60
     agcgacccct acgacgtgat gggcgcgggt gccgtgcgcg aagcactgat cgatgccgga       120
     atcgattacg cggacgtgca gcaggcctac gccggctatg tctacggcga ttcgacctgc       180
     ggtcagaaag cgctttacca cgtcggcatg accggcattc cgatcatcaa cgtgaacaac       240
     aactgcgcga cgggttcgtc agccttgttc cttgcgcgcc aggctgtgca aagcggcgcg       300
     gtcgattgcg cactcgcggt cggtttcgaa ttcatgcagc cgggcgcgct ctcgtcgaag       360
     tggagcgatc gtgcaccggc gctcgaacgc gcgctgagtg tggtcaacga actggtggat       420
     cgcaccgatc tgccgagcgc gattcgccag ttcagcggcg ccggccgggc tcacatggaa       480
     aagtacggca cgaagctcga aacgttcgcg aagattcgcg cgaaggcgag ccagcatgcc       540
     gcgcgcaatc cgctcgccgt gttccgcacg gtcgtgacgc cggaagaagt gctcgcatcg       600
     ccgatgatct gggaaggcgt gctcacgcgt ttgatggcct gcccgcccac ctgcggcgca       660
     gccgcggcca tcgtggtgtc ggaggaattc gcccgcaagc gcggcctgcg caccgatgtg       720
     ctgatcgccg cccagtccct caccaccgac ctgcccagca cgtacgactc acgcgacatg       780
     atccgcgtag tcggcttcga catgacgcgc gccggcgcga agctcgctta tgagcaggcc       840
     ggcgtcggtc cggaagacat cgacgtgatc gaactgcacg actgcttcgc gcagaacgaa       900
     ctgctgacct atgaaggtct gggtctgtgc gcagaaggcg aagcggaaaa actcgtcaac       960
     gacggcgaca acacgtatgg cggcaagtgg gtggtcaacc cgtcgggcgg tttgctgtcg      1020
     aaggggcatc cgttgggcgc gaccggtctc gcgcagtgct acgagctgac gcatcaactg      1080
     cgcggcactg ccgatcaacg ccaggtggaa ggcgcgaagg tcgcacttgc gcacaacctg      1140
     gggctcggcg gagcgtgcgt cacgaccgtg tacaaggccg cgtag                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page