(data stored in ACNUC7421 zone)

EMBL: CP000271.PE304

CP000271.PE304       Location/Qualifiers
FT   CDS_pept        complement(352939..353580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2721"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2721"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33272"
FT                   /db_xref="InterPro:IPR021312"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RL7"
FT                   /protein_id="ABE33272.1"
FT                   /translation="MSASASEISMSAIPSNPSTRQLVHTRRVECMGFKRRDGLFDIEGH
FT                   IRDTKADDSDLLFKTVPAGSPIHDMRIVVTIDSELLIHRIEAHTDSSPSRFCTEINEAY
FT                   AGLEGMTIGAGFMKEVKSRLSGPKGCTHLTELLGPIATTAIQTLMGWRKAAPAGRDSGE
FT                   ATGSAQAHPMVDTCYAWRAGGDVVQFVARRKQESVRGEAQTAGATPPPDQ"
     atgagtgctt cagcaagcga gatatccatg tctgccattc catcgaatcc ttcaacacgg        60
     cagctcgtgc atacccggcg tgtcgaatgc atgggcttca aacgacgcga cggcctgttc       120
     gacattgaag gccacatccg cgatacgaag gccgacgatt cggacctgct cttcaagacc       180
     gtgccggccg gctcgccgat tcacgacatg cgcatcgtgg tcacaatcga ttcagagctt       240
     ctgatccatc gcatcgaggc tcatacggac tcctcgccga gccgcttttg cacggaaatc       300
     aacgaggcgt atgccggtct cgaaggcatg accatcggcg cgggcttcat gaaagaggtc       360
     aagagccgtc tttccggtcc gaaaggctgc acgcatctga ccgagttgct cggccccatt       420
     gccacgacag cgatccagac attgatgggt tggcgcaagg cggcacccgc cgggcgagac       480
     tccggcgagg cgacaggcag cgctcaggct catccaatgg tcgacacctg ttacgcatgg       540
     cgcgcgggcg gcgacgtcgt gcaattcgtg gcacggcgca aacaggaatc ggtacgcggc       600
     gaagcgcaga ccgccggcgc gacgcccccg ccagaccagt ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page