(data stored in SCRATCH zone)

EMBL: CP000271.PE306

CP000271.PE306       Location/Qualifiers
FT   CDS_pept        355198..355548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2719"
FT                   /product="Putative phospholipid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2719"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33274"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RL5"
FT                   /protein_id="ABE33274.1"
FT                   /translation="MNQNKVFTLAGGVLLVLASFNVYAQGSDAAPASGHAYAPDAKAIK
FT                   AADRALQKNVVRALSRTKGLRAATITVRAHNGAVILEGTVPEQAQVGLATQAAEGVEGV
FT                   TSVTNALTLSTL"
     atgaatcaaa acaaggtatt cacgctggca ggtggggtgt tgctcgttct ggcgtcgttt        60
     aacgtgtacg cgcagggcag cgatgcggct cccgcgtcgg gccacgcgta tgcaccggac       120
     gcgaaagcca tcaaggccgc cgatcgtgcg ctgcagaaga acgtggttcg tgcgctgagc       180
     agaacgaaag ggctgagggc cgccaccatc acggtgcggg cgcacaacgg cgcggtgata       240
     ctggaaggaa ccgtgcccga acaggcgcag gtcggtctgg cgactcaggc ggctgaaggc       300
     gttgaaggcg tcacgtcggt gacgaacgcg ctgacgttgt ccacgttgta a                351
//

If you have problems or comments...

PBIL Back to PBIL home page