(data stored in ACNUC7421 zone)

EMBL: CP000271.PE312

CP000271.PE312       Location/Qualifiers
FT   CDS_pept        complement(363836..365875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2713"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2713"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33280"
FT                   /db_xref="GOA:Q13RK9"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR015289"
FT                   /db_xref="InterPro:IPR038964"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK9"
FT                   /protein_id="ABE33280.1"
FT                   /translation="MMSRGIGLVTVLLAISVGLAACDGDSGGPTASQAANVSTSGLAPA
FT                   NAAPASNDNASIDAATTTPLPCDAAATANTPCSAAHSVTRLLTRNYRGPLFQVQRASDN
FT                   AKQDIYPYTSSTLPHGADRSLIGSANVKSANTFCNNTTCSVTYIYDQIDLVAPLKGGAF
FT                   GNVPATLTLNPDGTESLTVPNSGSRPQKTTTVPVLNGFATITLPGTSGALAVQLSQPPT
FT                   ALTAQSPTLQLSIGNDLPALSGTPAKLGFVPLQGAQIPALGTLAGQAYRNRFGTVNQSI
FT                   GDSDIAEYMVAGAHYSQSSTCCGTYGNMENSANPGTYAHGEIEGEMFALAFSNGNAAVF
FT                   GYCDGNSNQPPNVKDPVCNARDTNWPGVDAEAGVYLYGPPQPAREKFVTVLSKYSPVTA
FT                   SNIFAVKGGSASQSVLTALYDQAPPEAYNFGNDAGHAFNGQWQGGLSLGEGGDGSAAPI
FT                   QFFEGAVITKATSDTTDNAIQASIASFYGPPADKAVAACYANNLINSPLSLATPDIWSQ
FT                   QNGGTAVPATDISGVNRGAATVTSTNGSSVSNVREIIRVQGGQSYSFTDYVLATSNATV
FT                   FPGGSIQTDDPSGTEFAWVLNTNTGAVVRGTWGAGQPTALSAVRSGNWWKVTMTLTAPA
FT                   GSNNASVFIDPPTSNAAGARSQQASYLSATHYCPSLAIVASSGT"
     atgatgtcca gaggaattgg attagttacc gttctattag cgataagcgt cggacttgcc        60
     gcatgtgacg gagatagcgg cggcccgacc gcgtctcagg cagcgaatgt atcgacttca       120
     ggtttggcac ccgcgaatgc cgcgcccgcg tcgaacgaca atgcatcgat agatgcggcg       180
     acaacgactc ccctaccttg cgacgccgcc gccacggcca acacaccatg ctccgcggct       240
     catagcgtca cacgcctgct gaccaggaat tacagggggc cgttattcca ggttcaacgg       300
     gcatccgaca atgcaaagca ggacatctat ccctatacgt ccagcacgtt gccgcacggt       360
     gctgaccgct cgctgatcgg ctcagccaat gtcaaaagcg cgaacacgtt ctgcaacaac       420
     accacctgtt ccgtcaccta catttacgac cagatcgacc tggtcgcgcc gctgaagggc       480
     ggagcgttcg gcaatgtgcc ggccacactc acactcaacc cggacggaac cgaatcactg       540
     accgttccga atagcgggtc gcggccgcaa aaaacaacga ccgtgccggt gctcaacggc       600
     tttgcgacga tcacgcttcc gggaaccagt ggagcgctgg ctgttcaact gtcgcagccg       660
     cctaccgcgc tgaccgccca gtcacccacg ctccagttat ctatcgggaa cgacttgccg       720
     gcgctctccg gcacaccggc gaaactgggc ttcgtgccgc tgcaaggcgc gcagattccc       780
     gcgctgggca cgttggcggg acaagcgtat cgcaacaggt tcggcacggt gaaccagtcg       840
     atcggcgata gcgacatcgc cgaatatatg gtggcggggg cgcactatag ccagtcctcc       900
     acgtgctgtg ggacttacgg aaatatggaa aacagcgcca atcccggcac ctacgcacat       960
     ggagaaatcg aaggcgagat gttcgcgctg gcgttctcaa atggcaacgc tgctgtattt      1020
     ggctactgtg acggcaattc gaaccagccg cccaacgtaa aagaccccgt ttgcaatgcg      1080
     cgcgatacca actggccggg tgtcgacgcg gaggcaggcg tctatctgta cggcccgccg      1140
     cagcctgcac gggaaaagtt cgtcaccgtg ctctccaaat actcgccggt gactgcgtcg      1200
     aatatcttcg ccgtcaaagg cggctcggcc tcgcagagtg tgctgacggc gctctacgat      1260
     caggcgcccc cggaagccta taacttcggc aacgatgcgg gtcacgcatt taacgggcaa      1320
     tggcaaggcg ggctgtcgct tggcgaaggc ggcgacggta gcgctgcgcc tatccagttc      1380
     ttcgaaggag cggtgatcac caaggcgaca tccgacacga ccgacaacgc gattcaggcg      1440
     agcattgcaa gcttttatgg accgccggcc gacaaggcgg tggccgcctg ctatgcaaac      1500
     aacctgatca actcgccgct gagtctcgcc acgccggata tctggtctca acagaatggc      1560
     ggcaccgccg tccctgcgac cgatatttcg ggagtgaaca gaggggccgc aacggtgacc      1620
     agtaccaacg gctcgtcagt ttcgaatgtc cgcgaaatca tcagggttca gggcggccaa      1680
     tcgtatagct ttactgacta tgttctcgcc accagcaacg cgacggtctt tcctggcgga      1740
     tcgatccaga ccgacgaccc gagcggcacc gaattcgcgt gggtcctcaa tacgaatacg      1800
     ggcgctgtag tgcgagggac gtggggcgcc gggcaaccca ctgcgctgag cgccgtgagg      1860
     tccggcaatt ggtggaaagt gacgatgacc ctgaccgctc ctgctggatc gaacaatgca      1920
     tcggtgttta tcgatccgcc cacgtccaac gctgccggcg cccgctcaca gcaagcgtcg      1980
     tacttgagcg caacgcatta ttgcccgagc cttgcaatcg tggccagttc gggaacgtag      2040
//

If you have problems or comments...

PBIL Back to PBIL home page