(data stored in ACNUC7421 zone)

EMBL: CP000271.PE313

CP000271.PE313       Location/Qualifiers
FT   CDS_pept        complement(366562..367944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2712"
FT                   /product="putative TRAP-type uncharacterized transport
FT                   system periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2712"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33281"
FT                   /db_xref="GOA:Q13RK8"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK8"
FT                   /protein_id="ABE33281.1"
FT                   /translation="MPPVRSTDQRDQTVPRHNPVLQRARKAPVKPRRPWLFITGAILLL
FT                   AVSGWVLAIILAPAFQHTIVVTSGADGGIYRGFADRYAPILKQKGITLDIRSSSGSVEN
FT                   YQRLKDPRSEYQVGFIQSGTTRPKETDDLKTIAAVSYEPIWVFYRGDTTIDRLAQLRGE
FT                   RISIGVPGSGLLNVALQLLAYSGVSGDNTTLLQMDAAKAYQSLENGQLDAAFFIGRPDA
FT                   EMQRTLLNSNLKLMSFAQADALVQKFPSLSKVIFPRGSTSIANDRPSADVTLLAATALL
FT                   VAKESLHPAFVYLLLDAASAVHGREDYFTPLGKFPNVNTDEFPVSDESIRYFKSGRPFL
FT                   QRYLPFWLASFVERRLLILLPFAALLLGVLQALPRIAETRIKNRLVVWYREVKLLEDEI
FT                   WRSDRPGREQISQWSEEIEQIDAHANQIRLPQRYLPDIYALKQAIDVVRGRISYMARQT
FT                   EK"
     gtgcctcccg tccggagcac ggaccagaga gaccaaaccg tgccaaggca caacccagtt        60
     ctccagcgcg cccggaaggc acccgtaaaa cccaggcgcc cgtggctctt catcacgggc       120
     gcgatcctgc tgctggccgt gtcaggctgg gtgctggcaa tcattctcgc gcctgcattt       180
     cagcatacga tcgttgtgac gtctggagcc gacggcggaa tctatcgcgg ctttgccgac       240
     cgctacgcgc cgatcctgaa acagaaaggc atcacgctcg atatccgtag ttcttccggt       300
     tcagtcgaaa actatcagcg gctgaaggac ccacgcagcg aataccaggt cggctttatc       360
     cagtccggca cgactcgccc gaaagaaacc gacgacctga aaacgatcgc cgcggtctcg       420
     tacgaaccga tctgggtctt ctatcgcggc gacactacga tcgaccggtt ggcgcaactg       480
     cgcggcgaac gcatttccat cggcgtgccg ggcagcggcc tgctcaacgt tgccctgcaa       540
     ctgctcgcct acagcggcgt ttcaggcgac aacaccacac tgttgcaaat ggacgcggcc       600
     aaggcttatc aaagtctgga aaacggacaa ctcgatgcgg cgttctttat cggcaggccg       660
     gatgccgaga tgcaacgaac cctgctgaac agcaatctga agctgatgag ctttgctcag       720
     gccgacgcgc tggtccaaaa atttccgtca ctctccaagg tcatttttcc gcgtggctcg       780
     acgagcattg ccaacgatcg cccgtcagcc gatgtcaccc tgctcgccgc cacggctttg       840
     ctcgtggcca aggaatccct gcatccagcc ttcgtctatc tgttgctgga tgcagccagc       900
     gctgttcacg gccgtgaaga ttacttcacg ccgctcggta agtttcccaa cgtcaacacc       960
     gacgaatttc ctgtttccga tgaaagcatc cgctatttca agtctgggcg ccccttcctt      1020
     cagcgctacc tcccgttctg gctggccagt tttgtcgaac ggcgtcttct gatcctgctg      1080
     ccttttgcgg ctttactgct tggcgtgctt caggcgttgc cgcgaatcgc ggagacgcgg      1140
     atcaaaaacc gcctcgtggt ctggtatcgc gaagtgaagc tgctggaaga tgagatatgg      1200
     cgaagcgacc gaccaggccg ggagcagatt tcgcaatgga gcgaagagat cgaacagatc      1260
     gacgcgcacg ctaaccagat acgcctgccg cagcgatatc ttccggatat ttacgccctc      1320
     aagcaggcta ttgatgtcgt gagggggcga atttcctata tggcacgaca gacggagaaa      1380
     tag                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page