(data stored in SCRATCH zone)

EMBL: CP000271.PE316

CP000271.PE316       Location/Qualifiers
FT   CDS_pept        complement(369471..370643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2709"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Endoribonuclease L-PSP domain present"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2709"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33284"
FT                   /db_xref="GOA:Q13RK5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK5"
FT                   /protein_id="ABE33284.1"
FT                   /translation="MNDATDIQEADVLVIGGGLHGTSSAFHMARRGANVIVLEADYVAR
FT                   HSSGVNAGGVRTLGRPLPEIPLALMSREIWHGMNDLLGEDGGFVPSGQLKIAETDDELE
FT                   ACRQRVALLESHGFTHEKVIDRQTVLDLEPALARHVTGGIWAERDGYALPYRTTTAFRL
FT                   AAQRLGARFLEGTPVRRIEQRGTRWFAVTPHGTFSAQKLLVTAGAWSGELAQQVGEPVP
FT                   VHPEGLMLMVTHRVAPFCSATLGATGRPLSFKQFDNGTVVIGGKLIGIADLAHRHGEVD
FT                   FVRLVRSARTVTDLFPHLRHLGVNRAWAGVEAFTEDELPVISASRKASDLYYSFGYCGS
FT                   GFQLGPGCGKLVSELMLDGAPSISLDAFAIDRFGRNAASSLTRAASLATH"
     gtgaatgacg cgaccgacat ccaggaagcc gatgtcctcg tgatcggcgg cgggctgcac        60
     ggcacgagca gcgcgttcca tatggcgagg cgcggcgcga acgtgattgt gctcgaagcc       120
     gattatgtgg cgcgtcactc ctcgggcgtg aatgcgggcg gcgtgcgcac gctggggcgt       180
     ccgttgccgg agattccgct tgcgttgatg tcgcgggaaa tctggcacgg catgaacgat       240
     ctgctgggcg aggacggcgg cttcgttcct tccggccagt tgaagatcgc cgaaacggac       300
     gacgaactcg aagcgtgccg ccagcgcgtc gcattgctcg aatcgcatgg attcacgcac       360
     gagaaagtga tcgaccggca aaccgtgctc gacctcgaac cggcgctcgc gcggcacgtt       420
     accggcggaa tctgggcgga gcgcgacggc tacgcgttgc cttatcgaac cacgacggca       480
     ttccggctcg ccgcgcagcg gctcggcgcg cgttttctgg aaggcacgcc ggtgcgccgc       540
     atcgagcagc gcggcacgcg atggttcgcg gtcactccgc atggcacgtt cagcgcgcaa       600
     aagctgctcg tcaccgcggg cgcatggtcc ggcgaattgg cgcagcaggt cggcgagccc       660
     gtgccggtgc atcccgaagg tttgatgctg atggtcacgc atcgcgtcgc gcccttctgt       720
     tccgcgacgc tcggcgcaac cggcaggccg ctgtccttca agcagttcga caacggcacg       780
     gtggtaatcg gcggaaaact gatcggcatt gcggacctgg cccatcgcca cggcgaagtc       840
     gatttcgtcc gcctcgtgcg tagcgcacgg accgtgaccg atctgtttcc tcatctgcgc       900
     catctcggcg tgaaccgcgc atgggccggt gtcgaggcct ttaccgaaga cgaactgccg       960
     gtgatctccg cgagccgcaa ggcgtctgat ctgtattact cgtttggcta ttgcggcagc      1020
     ggcttccagc tcgggccggg ctgcggcaag ctcgtgtccg aactgatgct cgacggcgcg      1080
     ccgtcgattt cgctcgatgc gtttgccatt gatcgcttcg gccgcaatgc ggcatcttcc      1140
     ctcacgcgcg ccgcgtctct cgcgacgcat taa                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page