(data stored in SCRATCH zone)

EMBL: CP000271.PE317

CP000271.PE317       Location/Qualifiers
FT   CDS_pept        complement(370636..372054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2708"
FT                   /product="Putative opine oxidase subunit a"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2708"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33285"
FT                   /db_xref="GOA:Q13RK4"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041117"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK4"
FT                   /protein_id="ABE33285.1"
FT                   /translation="MAADFASEFASETVDVVVVGAGPAGMSAATRTARAGLRTVLIDEQ
FT                   DAVGGQIYRGIGRADARRKEILGPDYAAGAAIADAFAASGAHHVTNATVWQVTRERGVN
FT                   YLKDGKIGSFDAKCVILASGALERPFPIPGWTLPGVLTAGAAQILLKSAGEVPAAPPVL
FT                   AGCGPLLYLLGWQYVRAGVPIRALVDTTRHEDRWRAKRHVVSALRAWPFLSKGLQLIRT
FT                   LRQAGVPIFEAADDLRVEARIGTDHVERAAALHFTTQGTAHRIEADVILLHQGVVPNTQ
FT                   FTQALRAAHRWDNAQLCFTPKVDAWGELDVPGIFIAGDGAGIGGAQAAALQGTLAGLAA
FT                   AAQLGALTTAMRDAEAVAHRRALADVMRIRPFLDSLYRPRDINRIPRDETIVCRCEEVT
FT                   AGELRKFVELGCVGPNQAKSFGRCGMGPCQGRMCGLTVTEVIADARRVSPAEVGYYRIR
FT                   PPIKPLTLGELAGE"
     atggccgctg atttcgcatc tgaattcgct tccgaaaccg tcgatgtcgt cgtggtgggc        60
     gccggccccg ccggcatgag cgcggcgacg cgcacggcgc gcgccggcct caggaccgtg       120
     ctgatcgacg aacaggacgc cgtgggcggc cagatctatc gcggcatcgg ccgcgccgat       180
     gcgcgccgca aggagattct cggaccggac tacgcggcgg gcgccgccat cgccgatgcg       240
     ttcgccgcct ccggcgcgca ccacgtgacc aatgcgaccg tgtggcaggt cacgcgcgag       300
     cgcggcgtca attatctgaa ggacggcaag atcggcagct tcgacgcgaa atgcgtgatt       360
     ctcgcgagcg gcgcattgga gcggcccttc ccgattcccg gctggacgct gcccggcgtg       420
     ctgacggcgg gcgccgcgca gattcttttg aagagcgcgg gcgaagtgcc cgccgcgccg       480
     ccggtgctcg cgggctgcgg accgctgctg tatctgctcg gctggcaata cgtgcgcgcc       540
     ggcgtgccga tccgcgcgct ggtcgacacc acgcgtcacg aagaccgctg gcgcgcgaaa       600
     cgtcacgtgg tgtcggcact gcgcgcgtgg ccgttcctga gcaaaggcct gcaactgatc       660
     cgcacgctgc gccaggcagg cgtgccgatc ttcgaggcgg cggacgatct gcgcgtggaa       720
     gcgcgcatcg gcacggatca tgtcgagcgc gccgctgcgc ttcacttcac gacacaaggc       780
     acggcacatc gtatcgaagc cgatgtgatc ctgctgcatc agggcgttgt gccgaacacg       840
     caattcacgc aggcgctgcg cgccgcgcac cgctgggaca acgcgcagct ctgcttcacc       900
     ccgaaagtcg atgcatgggg cgaactggat gtgccgggca tcttcatcgc gggcgacggc       960
     gcgggcattg gcggcgcgca ggcggcagcc ttgcagggca cgctcgcggg tctcgcggca      1020
     gccgcgcaac tcggcgcgct caccacggcg atgcgtgatg cggaagccgt cgcgcaccgc      1080
     cgcgcactcg cggatgtgat gcgcatccgg ccgtttctcg acagcctgta ccgtccgcgc      1140
     gacatcaacc gcattccgcg cgacgagacc attgtgtgcc gttgcgagga agtcactgcg      1200
     ggagagttac gcaagttcgt cgagctcggc tgtgtcggac cgaatcaggc aaagtcgttc      1260
     ggacgctgcg gcatgggtcc gtgtcagggg cgcatgtgcg gcctcacggt cacggaagtg      1320
     atcgccgacg cgcgccgcgt ctcgcccgcc gaagttggct actaccgcat ccgtccgccg      1380
     atcaagccgc tcacgctggg agagcttgcc ggtgaatga                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page