(data stored in SCRATCH zone)

EMBL: CP000271.PE318

CP000271.PE318       Location/Qualifiers
FT   CDS_pept        complement(372044..372415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2707"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2707"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33286"
FT                   /db_xref="GOA:Q13RK3"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK3"
FT                   /protein_id="ABE33286.1"
FT                   /translation="MTTQPTHTLFKPLPGAQGAAAANVAIWFNDQPLSVPGGRSVAAAL
FT                   LAAGVSRFRATPVSGAPRGPFCMMGACFECLVEIDGVPSRQACMVEVKAGMRIHSQEGA
FT                   RDLPPASMTDAPLENAHGR"
     atgactaccc aaccgactca cacactcttc aagccgctgc cgggcgcgca aggtgcggcc        60
     gccgcgaacg tcgcgatctg gttcaacgat cagccgctgt ccgtgcccgg cggccgctcc       120
     gtagcggcgg ccctgctcgc cgcaggcgtg tcgcgctttc gtgcgacgcc cgtgtccggc       180
     gcaccgcgcg ggcctttctg catgatgggc gcgtgcttcg aatgtctggt cgagatcgac       240
     ggcgtgccga gccgccaggc ttgcatggtc gaagtcaaag ccggcatgcg gatccattcg       300
     caagaaggcg cccgcgatct gccgcccgcg agcatgacgg acgcaccgct ggagaacgca       360
     catggccgct ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page