(data stored in ACNUC7421 zone)

EMBL: CP000271.PE320

CP000271.PE320       Location/Qualifiers
FT   CDS_pept        complement(373556..374353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2705"
FT                   /product="ABC spermidine/putrescine family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2705"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33288"
FT                   /db_xref="GOA:Q13RK1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK1"
FT                   /protein_id="ABE33288.1"
FT                   /translation="MKQNGILGLVYNAFFLTFILAPLVVVMLVAFTDKGFISMPFDGAS
FT                   LRWFRAILENDDIVSAFWLSVRLAFVAATIGVLLAVPAALAIARYRFPGRAALTSFFLS
FT                   PMMIPAVVLGIAFLRFLSLLHLSGSFWSLVCAHVIIVLPYALRLALSSAVGLDRDAERA
FT                   ALSCGASRFTAFRRVVLPMIRTGVAGGWVLSFIQSFDELTMTIFVATPGTTTLPVAMYN
FT                   QIAQTIDPLVASVSAVLIVGTVLLMILLDRMVGLDRILIGEAR"
     atgaaacaga acggcattct cggcctcgtc tacaacgcgt tttttctgac cttcatcctc        60
     gcgccgctcg tggtggtgat gctcgtggcg ttcacggaca agggcttcat ctcgatgcct       120
     ttcgatggcg cgtcgctgcg ctggttccgc gcgatcctcg aaaacgacga catcgtctcg       180
     gcattctggc tgtcggtgcg gctcgcgttc gtagcggcga ccatcggcgt gctgcttgcg       240
     gtgcccgccg cgctggcgat cgcccgctat cgctttccgg gccgcgccgc gctcaccagc       300
     ttctttctct cgccgatgat gatccccgcc gtcgtgctcg gcatcgcgtt cctgcgcttt       360
     ctgtcgctgc tgcatctgtc cggatcgttc tggtcgctgg tctgcgcgca cgtgatcatc       420
     gtgctgccgt atgcgctgcg cctcgcgttg tcgtcggcgg tcgggctcga tcgcgatgcc       480
     gaacgcgccg cgctctcctg cggcgcgagc cgcttcaccg cgtttcgccg cgtcgtgctg       540
     ccgatgatcc gcaccggcgt agcgggcggc tgggtcctct cgttcatcca gagtttcgac       600
     gaactgacca tgaccatctt cgtcgcgacg cccggcacga ccacgctgcc cgtcgccatg       660
     tacaaccaga tcgcgcagac gatcgatccg ctggtcgctt cggtgtcggc ggtgctgatc       720
     gtcggcacgg tcctcctgat gatcctgctc gaccgcatgg tcggactgga tcgcattctg       780
     atcggagaag cccgatga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page