(data stored in ACNUC7421 zone)

EMBL: CP000271.PE321

CP000271.PE321       Location/Qualifiers
FT   CDS_pept        complement(374370..375242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2704"
FT                   /product="ABC spermidine/putrescine family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2704"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33289"
FT                   /db_xref="GOA:Q13RK0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK0"
FT                   /protein_id="ABE33289.1"
FT                   /translation="MATLDDARPGAAPWLLSGPALLLFVGLLLVPLLLTLMLSFRVFSD
FT                   TAGVTAAYTLANYWEVVSDPYYGTIFLRTAGLAFAVTLLSIVLGVPETIVLARMKRPWQ
FT                   SLCLLIVLGPLLISVVVRTLGWQILLGNNGVLNNILQTLHITDEPIRLVFTMTGMIIAL
FT                   THVLVPFMVMSVWATMQKLDPQVEWAGRSLGGSPFAVFRRVVLPQIMPGVLSGSIIVFA
FT                   LSASAFATPALIGGRRLKVVATAAYDEFLGTLNSPLGASIAVLLLIANVAIVMGCSRLA
FT                   ERRFQHIFD"
     atggccacgc ttgacgacgc ccgccccggc gccgcgccgt ggttgctgtc ggggcccgcg        60
     ctgctgctgt tcgtcggcct gctgctggtg ccgctgctgc tcacgctgat gctgtcgttc       120
     cgcgtcttca gcgacacggc cggcgtgacc gccgcctata cgctcgcgaa ctactgggaa       180
     gtcgtcagcg atccttacta cggcacgatc tttctgcgca cggccggcct cgccttcgcc       240
     gtcacgctgc tgtccatcgt gctcggcgtg ccggaaacca tcgtgctcgc gcgcatgaaa       300
     cggccgtggc agtcgctctg tctgttgatc gtgctgggcc cgctgctcat ttccgtggtg       360
     gtgcgtacgc tcggctggca gattctgctc ggcaacaacg gcgtgctcaa caacattctc       420
     cagacactgc atatcaccga cgaacccatc cgcctcgtct tcacgatgac cgggatgatc       480
     atcgcgctca cccatgtgct ggtgcccttc atggtgatgt cggtctgggc gaccatgcag       540
     aagctcgatc cgcaggtgga atgggccggc cgctcgctcg gcggctcgcc gttcgcggtg       600
     ttccgccgcg tggtgctgcc gcagatcatg ccaggcgtgc tgtcgggctc gatcatcgtg       660
     ttcgcgttgt cggcctcggc gttcgccacg cccgcgctga tcggcggccg gcgcctcaaa       720
     gtggtcgcca ccgccgccta cgacgaattc ctcggcacgc tcaactcgcc gctcggcgcg       780
     agtatcgcgg tgctgctgct gatcgcgaac gtggcgatcg tgatgggttg cagccggctt       840
     gccgaacgcc gcttccagca catcttcgac tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page