(data stored in ACNUC7421 zone)

EMBL: CP000271.PE322

CP000271.PE322       Location/Qualifiers
FT   CDS_pept        complement(375229..376308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2703"
FT                   /product="ABC spermidine/putrescine family transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2703"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33290"
FT                   /db_xref="GOA:Q13RJ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RJ9"
FT                   /protein_id="ABE33290.1"
FT                   /translation="MAFLTLQNISKRYGDFTAIEHLDLSVERGELLSLLGPSGCGKTTT
FT                   LQMVAGFVTPTTGSILLDGRDITHERPEKRGIGVVFQSYALFPHMTVAGNVGFGLEMRK
FT                   VRRKEREERVAEALSLVRLKGLGHRYPKELSGGQRQRVAIARAIAMQPELLLLDEPMSN
FT                   LDAKLREEMHIELRTIQKRLGITTILVTHDQVEAMTMSDRIAVMHRGTIAQLSTPYDAY
FT                   ERPATPFASTFLGRTNAFSGEVLRRNPRCAEVDVAGTTLHVPHEGRHVVGAVNVYIRPE
FT                   KVYLANGDARVRGRISTRVFVGNQWLLEVDTELGKLRIAQPNHGAPPPEEGQEVGLAWT
FT                   DDDLRVLTQDNPERTHGHA"
     atggccttcc tgactctgca gaacatctcg aaacgctacg gcgatttcac ggcaatcgaa        60
     cacctcgatc tttctgtcga gcgcggtgaa ctgctgtcgc tgctcggacc atcgggctgc       120
     ggcaagacca ccacgctgca aatggtcgcg ggcttcgtca cgccgaccac cggcagcatc       180
     ctgctcgatg gtcgtgacat cacgcatgaa cgtcccgaga agcgcggcat cggcgtggtg       240
     ttccagagct atgcgctgtt tccgcacatg acggtggcgg gcaacgtggg cttcggcctg       300
     gagatgcgca aggtcaggcg caaggagcgt gaagagcgcg tcgccgaagc gctttcactg       360
     gtgcggctga aaggcctcgg tcatcgttat ccgaaggaac tgtcgggcgg ccagcggcag       420
     cgtgtggcga ttgcgcgcgc cattgcgatg caacccgaac tgctgctgct cgacgaaccg       480
     atgtccaacc tcgacgccaa gctgcgcgaa gagatgcaca tcgaattgcg cacgatccag       540
     aagcgcctcg gcatcacgac gattctcgtc acgcacgatc aggtggaagc gatgaccatg       600
     agcgatcgca tcgcggtgat gcatcgcggc accattgcgc aactgagcac gccgtacgac       660
     gcatacgaac gtcccgccac gccgttcgca tcgacgtttc tcggacgcac caacgcgttt       720
     tccggggaag tgctgcggcg caatccgcgc tgcgcggaag tcgacgttgc cggcaccacg       780
     ctgcacgtcc cgcacgaggg ccgccatgtt gttggcgcgg tgaacgtcta tatccgcccg       840
     gaaaaagtct atctggccaa tggcgacgcc cgggtacgcg gccgcatctc gacgcgcgta       900
     ttcgtcggca atcaatggct gctcgaagtg gacaccgaac tcggcaagct gcgcatcgcg       960
     caaccgaacc acggcgcgcc gccgcccgaa gaagggcagg aagtcggcct cgcgtggacc      1020
     gacgacgacc tgcgcgtgct cacgcaggac aacccggaga gaactcatgg ccacgcttga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page