(data stored in ACNUC7421 zone)

EMBL: CP000271.PE323

CP000271.PE323       Location/Qualifiers
FT   CDS_pept        complement(376367..377518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2702"
FT                   /product="ABC spermidine/putrescine family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2702"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33291"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RJ8"
FT                   /protein_id="ABE33291.1"
FT                   /translation="MIGRRETAFYSTGSEARPPPTPELEIVVMRSALHRRLSAPSRTAI
FT                   AALSFVSALAAPLAAHAETTLYVANVGGSNEQVYRQKIIPPFEKAHNVRIVYVAGNSSD
FT                   TLAKLQAQKGHQQINVAVMDDGPMYQAMQLNLCAKLDDAPVMKDLYPLAKLGPTAIGVG
FT                   MVATGIGYNEEAFRKAGLPPPDSWKALTDPRIKGKLGVPPITNTYGLHTLVMLARLSGG
FT                   GEKNIDPGFTAMTKQVAPNVLSWAPTPGEMDGQMQSGDVILAPYGSGRAVALQNTGFPL
FT                   KFIYPKEGAVALQVAACVVAENAQPQLSQQFVQYLLSPEVQALQAQGIGLGPVNKTVKL
FT                   TPEVAARVPYGPEQISKLTAMDWTTINQHRTEWTERWNRSVER"
     atgattggcc ggcgcgaaac tgcattctat tcgacgggca gcgaagcccg ccctcccccc        60
     acaccggaac tggagatcgt cgtcatgaga agcgcgttgc atcgccgtct gtccgccccg       120
     tcccgcaccg ccatcgcggc gctttcattt gtttccgcgc tggccgcgcc tctcgccgcg       180
     cacgccgaga ccacgttata tgtagccaac gtgggcggct cgaacgagca ggtctaccgc       240
     cagaaaatca ttccgccgtt cgagaaagcg cataacgtca ggatcgtcta cgtcgccgga       300
     aattcgagcg atacgctcgc caagctgcag gcgcagaaag gccatcagca gatcaacgtc       360
     gcggtcatgg acgacggtcc catgtaccag gccatgcagc tcaacctgtg cgcgaagctc       420
     gacgacgcgc ccgtgatgaa agacctctac ccgctcgcga agctcgggcc gacggcgatc       480
     ggcgtcggca tggtggcaac cggcatcggc tacaacgagg aagcgttcag gaaggctggc       540
     ctgccgccgc ccgactcgtg gaaggcgctc accgatcctc gcatcaaggg caaactcggc       600
     gtgccgccga tcaccaacac ctacggcctg catacgctcg ttatgctcgc gcgtctttcc       660
     ggcggcggcg agaagaacat cgatccgggc ttcaccgcaa tgacgaagca agtcgccccg       720
     aacgtgctgt cctgggcacc gacgcccggc gagatggacg gccagatgca atccggcgac       780
     gtgatcctcg cgccatacgg cagcggccgc gcggtcgcat tgcagaacac cggttttccg       840
     ctcaagttca tttacccgaa ggaaggcgcg gtcgcgttgc aggtagccgc atgcgtggtc       900
     gcggaaaacg cgcagccgca gttgtcgcag cagttcgtgc aatacctgct gagcccggaa       960
     gtgcaggcgt tgcaggcgca aggcattggt ctgggtccgg tcaacaagac cgtcaagctc      1020
     acacccgaag tagccgcgcg cgtgccctac ggtccggagc agatctcgaa gctgaccgcg      1080
     atggactgga ccacgatcaa ccagcatcgc accgagtgga ccgagcgctg gaaccgttcg      1140
     gtcgaacgct ga                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page