(data stored in ACNUC7421 zone)

EMBL: CP000271.PE326

CP000271.PE326       Location/Qualifiers
FT   CDS_pept        379348..380214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2699"
FT                   /product="transketolase subunit B"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2699"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33294"
FT                   /db_xref="GOA:Q13RJ5"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RJ5"
FT                   /protein_id="ABE33294.1"
FT                   /translation="MVGMTADLGKYTDLHIFGKEFPERYYQMGMAEQLLMGAAAGMAHE
FT                   GAQPFVTTYAVFATRRAYDFMHQAIAEDNLDVKIICALPGLTTGYGPSHQAAEDLALMR
FT                   AMPNMTVIDPCDALDTEQMVPAIAAHNGPVYARLLRGNVPAVLDEYDYQFELGKAKLLR
FT                   DGAEVLIISSGIMTMRSLEVAKLLQADKVGVGVLHVPTIKPLDTETILREARRTGRMVV
FT                   VAENHSVIGGLGEAVATTLLTAGVTPTYRQIALPDQFLAAGALPTLHDRYGISTSVMAE
FT                   NIKGWLG"
     gtggtcggca tgaccgccga cctcggcaaa tacaccgacc tgcatatctt cggcaaggaa        60
     ttccccgaac gttactacca gatgggcatg gccgagcaac tgctgatggg agcggcggcc       120
     ggtatggcgc atgaaggtgc gcagccgttc gtgacgacct atgcggtgtt tgcgacgcgc       180
     cgcgcgtatg acttcatgca ccaggccatc gccgaggaca acctcgacgt gaagatcatc       240
     tgcgcgctgc cgggtctcac gacgggttac ggaccgagcc accaggcggc cgaggatctt       300
     gccctgatgc gtgcgatgcc gaacatgacg gtgatcgacc cgtgcgacgc gctcgacacc       360
     gagcagatgg tgcccgctat cgccgcacac aacggtccag tgtatgcgcg tctgctgcgt       420
     ggcaatgttc cggccgtcct cgacgaatat gactaccagt tcgagctggg caaggccaag       480
     ctgcttcgcg acggggccga ggtgctgatc atctcgtcgg gcatcatgac gatgcgctcg       540
     ctggaggtgg cgaagttgct gcaagcggac aaagtgggcg ttggcgtgct gcacgtgccg       600
     accatcaagc cgctcgacac tgagacgatc ttgcgcgaag cccgacgcac gggtcggatg       660
     gtcgtggtcg ccgaaaatca ttcggtgatc ggcggccttg gcgaagcggt cgcgaccacg       720
     ctgctcacgg ccggcgtcac gccgacgtat cgtcaaatcg cactgcccga ccagttcctc       780
     gctgcgggcg cgctgccgac tttgcatgac cgatatggta tctcgaccag cgtgatggca       840
     gagaacatca agggatggct tggatga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page