(data stored in SCRATCH zone)

EMBL: CP000271.PE327

CP000271.PE327       Location/Qualifiers
FT   CDS_pept        380545..380853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2698"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2698"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33295"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RJ4"
FT                   /protein_id="ABE33295.1"
FT                   /translation="MNKATSTLIAAVAALALSGGAYAQSNNTLATPSVVSPAAVSPANA
FT                   TSGYGTSGATNSDSGMSGGSANPGLQQTTNTSSTPNASAYGVNNTLATPGTASPAGK"
     atgaacaagg caaccagcac attaatcgcg gctgtcgccg cactcgcgct ctcgggcggg        60
     gcctatgcac aaagcaacaa caccctggca accccgagcg tagtgtcgcc cgccgccgta       120
     tcgccggcca atgcgacgag cggctacggc acgtctggtg cgaccaactc ggacagcggc       180
     atgagcggcg ggtcggcgaa cccgggcctg cagcaaacca cgaatactag ctcgacgccc       240
     aacgccagcg cttacggggt caacaacacg ctggcaactc caggcacagc gtcgccggcg       300
     ggtaaataa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page