(data stored in SCRATCH zone)

EMBL: CP000271.PE33

CP000271.PE33        Location/Qualifiers
FT   CDS_pept        35915..36631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2995"
FT                   /product="ABC glycine betaine/choline/proline family
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2995"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33001"
FT                   /db_xref="GOA:Q13SD8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD8"
FT                   /protein_id="ABE33001.1"
FT                   /translation="MIQRPARLIGSLVAIGVVVALLGRAIDFGALHQYTPDLVYYTKRH
FT                   LLLVGYSMALALLVGIPAGVLLSRPSFARHAERFMQIFNIGNTIPSLAVLAIALGIFGI
FT                   GDIPALIALFLASLLPITRNAYEGMKNVSPALREAARGLGMTGWQSLLRVELPNAMPII
FT                   IGGVRTALAINVGSAPLAYLIGADSLGTLIFPGIYLNNQQQLLLGAAATAILALVLDGI
FT                   VSAGSRYLLARRGVTA"
     atgattcaac gtcctgccag actgatcggc agtcttgtag ccatcggtgt tgtcgtcgcg        60
     ttgctgggtc gtgcgatcga cttcggcgcg ctgcatcagt acacgcctga tctggtctac       120
     tacacgaaac ggcatctgct gctggtcggt tattcgatgg ctctcgcgct gctggtcggc       180
     attcccgccg gtgtgctgct cagccgcccg tcgttcgcgc gtcacgccga acgcttcatg       240
     cagattttca acattggcaa cacgattccc tcgctggcgg tgctcgcaat cgcgctcggc       300
     atcttcggca tcggcgatat tccggcgctg atcgcgctgt ttctcgcgtc gttgctgccc       360
     atcacacgca acgcttacga aggcatgaaa aacgtctcgc ccgcgctgcg cgaagccgcg       420
     cgcggtctcg gcatgacggg ctggcagtcg ctgttgcgcg tggagttgcc taacgcgatg       480
     ccgatcatca tcggcggcgt gcggactgcg ctggcgatca acgtgggcag cgcgccgctc       540
     gcgtatctga tcggcgcgga cagtctcggc acgctgattt tcccgggcat ctacctgaac       600
     aatcagcagc agcttctgct cggcgcagcg gccaccgcaa ttctcgcgct ggtgctggac       660
     ggcatcgtct cggccggcag ccgctacctg ctcgcgcgac gcggggtgac ggcatga          717
//

If you have problems or comments...

PBIL Back to PBIL home page