(data stored in ACNUC7421 zone)

EMBL: CP000271.PE332

CP000271.PE332       Location/Qualifiers
FT   CDS_pept        385681..387087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2693"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2693"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33300"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RI9"
FT                   /protein_id="ABE33300.1"
FT                   /translation="MYSKTQIDPVVSFRNSQGEQVRGTIINLQRKSLVMEVYNPYSIVQ
FT                   VSEVLSDLSVKMGTEHAYSGKAVVISMVNTGLTAIVSVTLIAEWLELSGGALEAPAVGE
FT                   EARRFVQDWSERFKIRRDYQIAVNQIRAFLSDMSRWVEQADLVDTMPKEGKTLRQDFFL
FT                   ELASPLMERTKVYFDEFEGEARLVDEELAPAHRAFAQAALHPLLLRSPFVFRTFTKPLG
FT                   YAGDYQMVNQMLDDPRQGPSTYFQIVNAAFLQTAVARAHRNRVELLVDYLTRLANEARA
FT                   AQRPFRVLNVGCGPAQEIQRFMHEYDEPEWLTFELLDFSQETLDWTRDRLGSIAQKTGR
FT                   RMTISYTHDSVHHLLKRRMDADAADVREFDAVYCAGLFDYLSDKVCARLNQHFASRTRR
FT                   GGRLLVTNVHADNPERFSMEHVLEWYLIYRNEAQMAEIMPDSCGEPRLYTDSTGVNVFA
FT                   EATIGPQQVA"
     gtgtattcca aaacacaaat cgatccggta gtgagcttcc ggaactcgca gggcgagcag        60
     gtgcggggca cgatcatcaa tctccagcga aagtccctgg tgatggaggt ctataacccg       120
     tattcgattg tccaggtcag cgaggtgctg agcgacctgt cggtcaagat gggcacggaa       180
     cacgcctatt cgggtaaggc ggtcgtaatc agtatggtca ataccggcct gacagccatt       240
     gtctcggtaa cgctgatcgc cgagtggctg gaactgagcg gcggcgcgct ggaagccccc       300
     gcggtggggg aagaagcccg ccggttcgtg caggactggt ccgagcgttt caagatccgc       360
     cgcgactacc agatcgcggt caaccagatc cgggcttttc tgtcggacat gtcgcgctgg       420
     gtcgagcagg ccgacctggt cgacaccatg ccgaaggaag gcaaaaccct gcgccaggac       480
     ttcttcctcg aactggcgtc gccgctgatg gaaaggacca aggtctactt cgacgaattc       540
     gaaggcgagg cgcggctggt cgacgaagaa ctggcgccgg cacaccgtgc ctttgcccag       600
     gccgcgctgc atcccctgct gctgcgctcg ccgttcgttt tccgtacctt cacgaagccg       660
     ctcggctatg ccggtgacta ccagatggtc aaccagatgc tcgacgatcc ccgccaggga       720
     ccgagcacgt atttccagat cgtcaacgcg gccttcctgc agacggccgt ggcacgcgcg       780
     caccgcaacc gcgtcgaact gctggtggac tacctgaccc ggctggccaa tgaagcgcgc       840
     gccgcgcagc ggccgttccg ggtgctgaac gtgggttgcg gccccgctca ggaaatccag       900
     cgcttcatgc atgaatacga cgaacccgag tggctgacgt tcgaactgct cgacttcagc       960
     caggagacac tggactggac gcgcgaccgc ctggggtcca tcgcgcagaa aaccggcagg      1020
     cgcatgacca tcagctatac acatgattcg gtccaccacc tgctcaagcg ccggatggac      1080
     gcggacgccg cggacgtccg cgaattcgac gcggtctatt gcgccggcct gttcgactac      1140
     ctgtcggaca aggtctgcgc gcggctgaac cagcatttcg ccagccgcac caggcggggc      1200
     ggccgtctgc tggtcaccaa tgtccatgcc gacaacccgg agcgcttcag catggagcac      1260
     gtgctggagt ggtacctgat ctatcgcaac gaggcacaga tggccgaaat catgccggac      1320
     agttgcggcg aaccgcgcct gtacacggac tcgaccggcg ttaatgtgtt tgccgaggcg      1380
     acgatcggcc cgcaacaagt agcctga                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page