(data stored in ACNUC7421 zone)

EMBL: CP000271.PE333

CP000271.PE333       Location/Qualifiers
FT   CDS_pept        387089..388426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2692"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2692"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33301"
FT                   /db_xref="GOA:Q13RI8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RI8"
FT                   /protein_id="ABE33301.1"
FT                   /translation="MTTSLAGLHSNYREELRDYRLLCSKAGGLTVIVLVLMGVALDYVV
FT                   YPAEQKRFAIVRVLTSAAIGLALLSLCTEAGKRHVQIITFFWLLLPQAMISWMIYVTQG
FT                   GESLFYAGLMLTIFAVGILFPSGYWQTLAFGLVTVLLYYVACAAHPGGIQNPSKFQFQL
FT                   ILIFFCALASSIYTYFNEKGRFQLFRLKDEVAHKNDQLARTNDNLAQIKGQLLQQEKMA
FT                   AIGTLSAGLLHEVNNPVNFCLMAIEVAMEEPQAKDSPSLQECLTDVKQGMLRIQHIVSD
FT                   LKTFAYRKPGATADDVPFLFEKALDASIRLSAHELRGVNVTRELPGDTLVLGDEAAIIG
FT                   VLINLFSNAALAMHKAGTVSPQVRITAQWRDDRLHVNVRDNGPGIAAENLARVFEPFFT
FT                   TRDVGQGLGLGLSISYAVVERHGGTLFAESQLGEWTAFNFDLPRVE"
     atgacaacat ccctggctgg gctgcattcg aactatcgtg aagagttgcg cgactaccgg        60
     ttgctgtgca gcaaggcggg cggcctgacc gtaatcgtgc tggtgctgat gggcgtggcg       120
     ctggattatg tcgtgtatcc ggccgagcag aagcgctttg ctatcgttcg ggtgctgacc       180
     agcgcggcca tcggcctggc tttgctctcg ctttgcacgg aagcaggcaa acgccacgtg       240
     cagatcatta ccttcttctg gctgttgctg ccgcaggcaa tgatctcctg gatgatttat       300
     gtcacgcagg gcggggagtc gctgttctat gccgggctta tgctgacaat ctttgcggtc       360
     ggaatcctgt ttccctcggg ctactggcag acgctggcat tcggcctggt tacggttctg       420
     ctctactacg tcgcctgtgc ggcacatccg ggcggcatcc agaacccaag caagttccag       480
     ttccagctga tcctgatctt cttctgcgcg ctggccagtt ccatttacac ctatttcaac       540
     gaaaaaggcc gtttccagct tttccggctg aaggacgagg tggcgcacaa aaacgaccag       600
     ctcgcccgca ccaatgacaa cctcgcgcag atcaagggcc agttgctgca gcaggagaag       660
     atggcggcaa tcggtacgtt gtccgcgggg ctgctgcacg aggtcaacaa cccggtgaac       720
     ttctgcctga tggccatcga agtagcgatg gaggagccgc aggccaaaga cagcccgtca       780
     ctgcaggagt gcctgacgga tgtcaagcag ggcatgcttc gcatccagca tatcgtgtcg       840
     gacctgaaaa cctttgccta ccgcaagccc ggcgcgacgg cagacgacgt gccgttcctg       900
     ttcgagaagg cgcttgacgc gtcgatccgg ctgagcgcac acgagctgcg cggcgtgaac       960
     gtcacgcgcg agctgcccgg cgacacgctc gtgctgggcg acgaagccgc catcatcggc      1020
     gtgctcatca atctgttctc gaatgccgct ctggccatgc acaaagccgg caccgtatcg      1080
     ccgcaggtcc gtatcacggc gcaatggcgc gacgaccggc tgcacgtgaa cgtgcgcgac      1140
     aacggcccgg ggatcgccgc cgagaatctg gcgcgggtgt tcgaaccatt ctttactacc      1200
     cgcgacgtcg gccagggcct tggcctcggt ctgtccatca gctatgcagt ggtcgagcgg      1260
     cacggcggca cactgtttgc ggaaagccag ctgggcgagt ggaccgcatt caattttgac      1320
     ctgccgcgtg tcgagtaa                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page