(data stored in ACNUC7421 zone)

EMBL: CP000271.PE334

CP000271.PE334       Location/Qualifiers
FT   CDS_pept        388434..388838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2691"
FT                   /product="Response regulator receiver domain protein(CheY)"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2691"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33302"
FT                   /db_xref="GOA:Q13RI7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RI7"
FT                   /protein_id="ABE33302.1"
FT                   /translation="MRETQQARHTVVYVDDEELARKYFARAAGSDFEVLLADGADEAMT
FT                   ILRREGPRVAILVTDFRMPGRHGGDLLRQVSQEYPHIVRILVTAYADKNALLEAVNSGE
FT                   VFQILEKPLGVGRVREVLASAATAPVLRPK"
     atgagagaga cccagcaagc ccggcacact gtcgtctatg tcgatgatga ggagttggcc        60
     cgcaagtact ttgcccgcgc ggccggcagc gactttgagg tgctgctcgc cgacggcgcg       120
     gacgaggcca tgaccatcct gcgccgcgaa ggtccgcggg tggcgatcct cgtgaccgac       180
     ttccgcatgc cgggccggca cggcggcgac ctgttgcggc aggtctcgca ggagtatccg       240
     catatcgtgc ggatcctggt gacagcctac gcggacaaaa acgcgctgct ggaagccgtc       300
     aattccggcg aggtgtttca aatcctggag aaaccgctag gcgtcggcag ggtccgtgag       360
     gtgctggcat cggcggccac ggcccccgtc ttgcgcccga agtga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page