(data stored in ACNUC7421 zone)

EMBL: CP000271.PE335

CP000271.PE335       Location/Qualifiers
FT   CDS_pept        388838..389026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2690"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33303"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RI6"
FT                   /protein_id="ABE33303.1"
FT                   /translation="MQRLPAAPVITHAGVSGFGMIFCNRVTQFFRGSIRIASASGAGMT
FT                   VTPEFPNFKDRTHRSYQ"
     atgcagcgct tgccggccgc cccggttatc acgcacgccg gcgtcagcgg cttcggcatg        60
     attttctgca accgcgtcac gcagttcttt cgcgggagta tcaggatcgc atccgcgtcc       120
     ggcgccggca tgaccgtgac gccggaattc ccaaatttca aggatcgaac gcacaggagt       180
     taccaatga                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page