(data stored in ACNUC7421 zone)

EMBL: CP000271.PE336

CP000271.PE336       Location/Qualifiers
FT   CDS_pept        389023..390042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2689"
FT                   /product="Response regulator receiver domain protein(CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2689"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33304"
FT                   /db_xref="GOA:Q13RI5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RI5"
FT                   /protein_id="ABE33304.1"
FT                   /translation="MSNTIANQTPLPAILFVDDEATAAKYFERAIGAIAPVVTGASVEE
FT                   GKAMLDAHAASLTVLVSDQRMPGEYGNELLRYARERYPHIVRILTTAYSELDQTVEAVN
FT                   QGQIHRYIKKPWDISALRMEMKQALELAGLRKERDQLVREKLGVLQTQTVATRIGTVYT
FT                   LCASLIGPGRFQPVETYLAGTELAGARNVEPDWQRMDYADLVHVESECSGSFGHAVGTR
FT                   LAELRTQNAGRSAVDAVQVLTEILGASVRGDGDALIWTSPATLSEFLARPVGQAVSAEH
FT                   AGWLAGLLWLEEAGGALRFVREGDTIVCRAGTRAASFSADRLAVWIERFSEQAFEQAT"
     atgagcaata cgattgccaa ccagacaccg ctcccggcga ttctgttcgt tgatgacgaa        60
     gccaccgcgg ccaaatactt cgaacgcgcc atcggcgcga tcgcgccggt ggtgacgggc       120
     gcctccgtgg aggagggcaa ggccatgctg gatgcccacg ccgccagcct gaccgtgctg       180
     gtgtccgacc agcgcatgcc gggcgaatat ggcaacgaac tgctgcgcta tgcgcgcgag       240
     cgctaccccc acatcgtccg gatcctgacg accgcctatt cggagctgga ccagaccgtc       300
     gaggccgtca accagggcca gatacatcgc tatatcaaga agccgtggga catcagtgcg       360
     ctgcgcatgg agatgaagca ggcgctggag ctggcgggac tgcgcaagga gcgcgaccag       420
     ctcgtgcgcg agaagctggg cgtgttgcag acgcagaccg tggccacccg catcggcacg       480
     gtgtacacgc tgtgcgccag cctgatcggc ccgggccgct tccagccggt ggagacctac       540
     ctggccggca ccgaactggc gggtgcgcgc aatgtggagc cggactggca gcgcatggac       600
     tacgccgacc tggtgcatgt cgagagcgaa tgcagcggca gcttcggaca cgcggtcggc       660
     acacgcctcg cggaactgcg tacgcagaat gcgggacgca gcgccgttga tgcggtgcag       720
     gttctcaccg aaatcctcgg cgcctcggta cgcggcgacg gcgatgcgct gatctggact       780
     tcgccggcta cgctgagcga gttcctcgcc cggccggtgg gtcaggccgt atcggccgag       840
     cacgcgggct ggctggctgg cctgctgtgg ctggaagaag cgggcggcgc gctgcggttc       900
     gtgcgtgaag gcgacaccat cgtctgccgc gccggcacac gcgctgccag tttttccgcc       960
     gaccgtctgg cagtctggat cgagcggttc tcggaacagg cgttcgaaca ggcgacgtag      1020
//

If you have problems or comments...

PBIL Back to PBIL home page