(data stored in ACNUC7421 zone)

EMBL: CP000271.PE339

CP000271.PE339       Location/Qualifiers
FT   CDS_pept        complement(392261..395146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2686"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2686"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33307"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RI2"
FT                   /protein_id="ABE33307.1"
FT                   /translation="MRVRQKSRNGTRREAGTLLLAALAGLPFMAMASPASPHADTAAVL
FT                   SGASSHAADPRLALANRTTPCALMLDNRGWSVTPFEKPKDERARCMNEAAQGNLTARAL
FT                   YGQMLTYGYGGERDTATGVAILKSSALDGSLLARRMLGNLYRNGSVVPQDYLAARQWFE
FT                   SAAADGDATSATVLGAMSANGEGQPVDNAAAYRYFVQAAEGGSANGAANAAQFAALGRG
FT                   VPKDPAVAASWMIRGASGGDAGAQFLLGLALLRGEGVPRDAGNGAGWLREAVRQGNTGA
FT                   EAALGDVYLSGVGVQRDTRRGFDLMSHAARQGWVYAQRRMGDLYATGTGVARNDVLARS
FT                   WYRKAAVEGDAAARFALADLYRTGRGGPVDLEAAIGWMRGAADAGLATAQNDLGVMFRE
FT                   GWGTHKDSAEARTWFEKARAQGLGVASFNLAIYALRGEGEPVDFGKAFKLASEGADRGS
FT                   EEAAVTAAAMAWKGQGTPVDKAQALRWYRFAADHGNVEAARWIGNQYLAGTEVPRDEAL
FT                   GLHYLTLATNAGDPASSVSLGAYLTEHGQSLSGKTGVEWLEAAAKRRVPAAYAALGYTY
FT                   ARGIAGKQDSGVALGWFSQGAQLGDPASQAWLCSAYAYGSPGVQRRPDYAARWCQAASR
FT                   SGNVLAMSILADARNGIANDTSRVYWQWKVADRGDPKYQSMLGDSYDLGDGVAPDLSAA
FT                   TYWFRRAADQGNASAQSSLAWHLLTGLGGRVDEYEAFAWASKAAPADPEAKRMVGVAYA
FT                   YGRGVGRDPAAGRVWLEKALAAGDDWAASDLATLYEIGPLAQREPARAMQLHRQGARGG
FT                   AEQSQIALALHALAAGTETDLGNNERRWLVPADAASNLWHDDSLAPAGELRQRWDGLSC
FT                   LNEALLGNPLMQYDVGMRFLTGNGVPRDRALGAAWIARARAGFEARGGVPAYTAAIRIV
FT                   EARLSERMGDDEKQRAREIAANLDATVREWQ"
     atgagggtgc gacaaaaatc gcgcaacgga acgcgtcgcg aagccggcac gctgctgctc        60
     gccgcgctgg caggcctgcc ttttatggca atggcgtcgc cggcatcgcc acatgcggat       120
     accgctgcgg tactttcagg cgcctcgtcg cacgccgcgg atccacgcct ggcgctcgcg       180
     aaccgcacga cgccttgcgc attgatgctc gacaatcgcg gctggagcgt gacgccattc       240
     gaaaagccga aagacgaacg cgcgcgatgc atgaacgagg cggcgcaagg caacctcacc       300
     gcacgggccc tctacggcca gatgttgacg tacggctatg gcggcgagcg tgacaccgcg       360
     acaggcgtgg cgatcctcaa gtcgtcggcg ctcgacggct cgctgctcgc acgccgcatg       420
     ctcggcaacc tctatcgcaa cggcagcgtg gttccacagg actatctcgc tgcgcgccag       480
     tggttcgaat cggctgccgc ggacggcgat gcgacatcgg ccacggtgct cggtgcaatg       540
     agcgcgaacg gagaaggcca gccggtcgat aacgccgccg cgtacaggta cttcgtccag       600
     gccgcagagg gtggctcggc gaacggcgcg gccaatgcgg cgcaattcgc cgcgctcggg       660
     cgcggcgtgc cgaaagatcc ggctgtcgcc gcttcgtgga tgatccgcgg cgcgagcggc       720
     ggcgatgcgg gcgcgcaatt cctgctcggc ctcgcgttgt tgcgcggcga aggcgtgccg       780
     cgcgacgcgg ggaacggcgc cggatggttg cgcgaagccg tgcgccaggg caacaccggc       840
     gccgaggcgg cgctaggcga cgtgtatctg agcggcgtcg gcgtgcagcg tgatacgcgc       900
     cgcggtttcg atctgatgtc gcacgcggcg aggcaaggct gggtctatgc gcagcgcaga       960
     atgggcgacc tctacgcaac cggcacgggt gtcgcgagga acgacgtgct ggcgcgttcg      1020
     tggtaccgga aggcagcggt cgaaggcgac gccgcagcgc gttttgcact cgcggacctc      1080
     tatcgcaccg gtcgcggcgg tccggtcgat ctggaggcgg ccatcggctg gatgcgcggc      1140
     gcggcggacg cagggctggc aacagcgcag aacgacctcg gcgtgatgtt ccgcgaaggc      1200
     tggggcacgc acaaggattc cgccgaagct cgcacatggt tcgagaaagc gcgcgcgcag      1260
     gggctcggcg tcgcctcgtt caatctcgcg atctatgcat tgcgcggaga aggcgagccg      1320
     gtcgacttcg gcaaggcgtt caaactggcg agcgagggcg cggatcgcgg cagcgaagag      1380
     gcggcggtca ccgccgcggc aatggcatgg aaggggcaag gcacacctgt cgacaaagcg      1440
     caggcgctgc gctggtatcg cttcgccgcg gaccacggca acgtggaggc ggcgcgctgg      1500
     atcggcaatc agtatcttgc gggcaccgag gtgccgcgtg acgaggctct cggcctgcac      1560
     tacctgacgc tcgcgacgaa cgcgggcgat cccgcgagca gcgtatcgct cggcgcttat      1620
     ctgaccgaac atggccagtc tttgtcgggc aagacgggtg tcgaatggct cgaagcggca      1680
     gcgaagcgcc gcgttcccgc agcttacgcg gcgctcggct atacgtacgc gcgcggcatt      1740
     gcgggcaagc aggattccgg cgtcgcgctg ggctggttct cgcaaggcgc gcaactcggc      1800
     gacccggcgt cgcaggcatg gctttgcagt gcgtacgcgt atggaagccc cggcgtgcag      1860
     cgtcgtccgg attatgcggc ccgctggtgt caggcagcat cgcgcagcgg caacgtgctc      1920
     gcgatgagca ttctcgccga cgcgcgcaac ggcatcgcca atgacaccag ccgggtgtac      1980
     tggcaatgga aagtcgcgga ccggggcgat ccgaaatacc agtcgatgct cggcgacagc      2040
     tacgatctcg gcgacggcgt cgctcccgat ctgtcagcgg cgacatactg gttccggcgc      2100
     gcggcggatc agggcaatgc ttccgctcaa agctcgctgg cgtggcacct gttgacgggc      2160
     ctgggcggcc gcgtcgacga gtacgaggcc tttgcgtggg catcgaaggc ggcgccggcc      2220
     gacccggaag cgaagcggat ggtgggcgtc gcttatgcgt atgggcgcgg cgtcgggcgt      2280
     gatccggctg cggggcgcgt ctggctcgaa aaagcgctgg ctgccggcga cgactgggca      2340
     gccagcgacc tcgcaacctt gtacgagatc gggccgcttg cgcagcgcga gccggcgcgt      2400
     gccatgcaac ttcatcgtca gggcgcgcgc ggcggggccg agcagtcgca gatcgcgctc      2460
     gctttgcacg cgctggcagc gggcacggaa acggacctcg gcaacaatga gcggcgctgg      2520
     ctggtgcctg ccgatgcggc gtcgaacctg tggcatgacg attcgctcgc gcccgccggc      2580
     gaactgcggc aacgctggga tgggttgtca tgcctgaacg aggcattgct cggcaatccg      2640
     ctgatgcaat acgacgtcgg catgcgcttt ctgaccggca acggcgttcc gcgcgaccgt      2700
     gcgctcggcg ccgcctggat cgcccgcgcg cgggcaggct tcgaagcccg cggcggcgtg      2760
     ccggcgtaca ccgccgcgat ccggatcgtc gaggcgcgac tgtccgaacg catgggcgat      2820
     gacgagaagc agcgcgctcg cgagatcgcg gcgaatctgg acgcgacagt gagggagtgg      2880
     cagtga                                                                 2886
//

If you have problems or comments...

PBIL Back to PBIL home page