(data stored in SCRATCH zone)

EMBL: CP000271.PE34

CP000271.PE34        Location/Qualifiers
FT   CDS_pept        36628..37524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2994"
FT                   /product="ABC glycine betaine/choline/proline family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2994"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33002"
FT                   /db_xref="GOA:Q13SD7"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD7"
FT                   /protein_id="ABE33002.1"
FT                   /translation="MIDLFKRIRWIAAGALFCASLQAGAATLVLGGKNFTEQYVLTEIT
FT                   SQYLRAKGYTIDARTGLGSTLLRSAQENGQVDITWEYTGTAAIVYNKITEKLDPKTMYE
FT                   RVKALDAKRGLVWLDCSPLNNTYALGLPQQVAQQTGIRTISQLAAKMAAEPKKKHVFAM
FT                   DAEFANRPDGLKPLEAAYGMQFSREETRQMDPGLVYTALHNNQVPIGLIYTTDGRVKGF
FT                   NIVPLEDDRHYFPAYNATPVVRKATLDQNPQLAPQLNALSDALNNDTMLEMNKQVDVDG
FT                   RPVREVAAEFLRTHKLP"
     atgatcgatc tgttcaaacg catccgctgg atcgccgccg gcgcattgtt ctgcgcgagc        60
     cttcaggccg gcgcggcgac gctcgtgctc ggcggcaaaa atttcaccga gcaatacgtt       120
     cttacggaga tcacgtcgca atacctgcgc gcgaaaggct acacgatcga cgcgcgcacc       180
     ggtctcggca gcacgctact gcgcagcgcg caggagaacg gccaggtcga tatcacatgg       240
     gaatacaccg gcacggcggc gatcgtctac aacaagatca ccgaaaagct cgatccgaaa       300
     acgatgtacg aacgcgtgaa agcgctcgac gcgaaacgtg gcctcgtctg gctcgattgc       360
     tcgccgctga acaacacgta cgcgctcggc ttgccgcaac aggtggcgca gcaaaccggc       420
     atccgcacga tttcgcagct cgccgcgaag atggcggcgg agccgaaaaa gaagcacgtg       480
     ttcgcgatgg atgcggagtt cgccaatcgc ccggacggcc tgaagccgct cgaagcggcc       540
     tacggcatgc agttcagccg cgaggaaacg cgtcagatgg atccgggcct cgtctacacg       600
     gcgttgcata acaaccaggt gccgatcggg ctgatctaca caacggacgg ccgcgtgaag       660
     ggcttcaaca tcgtgccgct cgaagacgac cgtcactact ttcctgcgta caacgccacg       720
     cccgtagtgc gcaaagcaac gctagaccag aacccgcaac tcgcgccgca actgaacgca       780
     ttgtccgatg cgctgaacaa cgacacgatg ctcgagatga acaagcaggt cgacgtcgac       840
     ggcaggccgg tgcgcgaagt cgcggcggaa ttcctgcgta cgcacaagtt gccctga          897
//

If you have problems or comments...

PBIL Back to PBIL home page