(data stored in ACNUC7421 zone)

EMBL: CP000271.PE340

CP000271.PE340       Location/Qualifiers
FT   CDS_pept        complement(395143..396516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2685"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33308"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RI1"
FT                   /protein_id="ABE33308.1"
FT                   /translation="MKLKTSFYGVMLFFTAVSANALDMRSAQPVAPAAQAQTAAPVDPA
FT                   ALTNERIRQIVGQAGLDPDSDKGRLLVKLVTRVAADAEFRNRLSTWSQTRGMFGGQLSP
FT                   DDRMRVLHLLKGLAQGPKSDCDALATNGRDFFLMAKTLSTQSFQNLLEIMEISVDHSTP
FT                   DSNDERYTTAELLDADAELESKVPSQFIAKGPSNACELIRVAVDAVDGLPPASRQAATY
FT                   ELFQIMDHKPSARAKVLTDPYAYLDDMFDERRMPDSIRRKLPENGSRPLPFSRLVVDAE
FT                   WKNPSTPNQPTPFKDTFVNRRNNGVVAELVTPAADSARLDWSDFYLSYGVASLLTQTVG
FT                   THELTPLGTLKDDVAVDTASRPLVEGHSIELALPLPSEKGETSRTCEIGKTVPASTLFR
FT                   SLDGDAVGLHCQSVTKRGETVRFDASLLVNYGIAWTTSIDDKDGRTDAIIRNVTVQQP"
     atgaagctca agaccagttt ctacggggtg atgctgtttt tcacggctgt cagcgcaaat        60
     gcgctggata tgcgaagcgc gcagccggtc gcgccggcag cgcaagcgca gacagccgcg       120
     ccggtcgatc ccgcggccct gaccaacgag cgtatccgcc agatcgtcgg acaggctgga       180
     ctcgatcccg attcggacaa aggccggttg ctggtcaagc tggtcacgcg ggttgcggcc       240
     gatgcggagt tccggaaccg gctcagcacg tggtcgcaaa cgcgagggat gttcggcggg       300
     cagttatcgc cggacgatcg catgcgcgtg ctgcacctgt taaaaggcct ggcgcaaggg       360
     ccgaagagcg actgcgacgc gctcgccacc aacggccgcg acttctttct gatggcaaaa       420
     acgctctcca cgcaaagttt ccagaatctg ctggaaatca tggagatttc ggtcgaccac       480
     agtacgcccg actcgaacga cgagcgatac accaccgcgg aactgctcga cgccgatgcg       540
     gagctcgaat cgaaagtgcc gtcgcaattc atcgccaagg gtccgtcgaa tgcctgcgag       600
     ctgattcgcg tcgccgtcga cgcggtcgac ggattgccgc ccgcatcgcg tcaggccgcg       660
     acgtacgagc tcttccagat catggatcac aagccatcgg cacgcgcgaa agtgttgacc       720
     gacccttacg cctacctgga cgacatgttc gacgagcggc gcatgcccga ttcgatccgc       780
     cggaagttgc cggagaacgg cagccgccct ttgccgttct cgcgtctggt agtcgatgcc       840
     gaatggaaga acccgtcgac gcccaaccag ccgacgccgt tcaaggacac cttcgtgaac       900
     cgtcgaaata atggcgtggt cgccgaactg gtgacgccgg ctgcggattc cgctcgactg       960
     gactggtccg acttctacct gagctacggc gtcgcgagcc tgctcacgca aaccgtcgga      1020
     acccacgagt tgacgccgct cggcaccctg aaggacgatg tggccgtcga caccgcgagc      1080
     cggccgcttg tcgaagggca cagcatcgag ctggcgcttc cgctgccatc ggaaaagggc      1140
     gagacctcgc ggacgtgcga gatcggcaag acggttcccg cctccacgct tttcaggtcg      1200
     ctcgacggag acgcggtcgg tctgcattgc cagtcggtga cgaagcgcgg cgagacggtg      1260
     cgcttcgatg catcgttgct cgtgaactac ggcattgcgt ggacgacatc gattgacgac      1320
     aaggacggcc ggaccgacgc catcatcaga aacgtgacgg tccagcagcc atga            1374
//

If you have problems or comments...

PBIL Back to PBIL home page