(data stored in ACNUC7421 zone)

EMBL: CP000271.PE341

CP000271.PE341       Location/Qualifiers
FT   CDS_pept        complement(396578..396910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2684"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2684"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33309"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RI0"
FT                   /protein_id="ABE33309.1"
FT                   /translation="MLPGWPRGRRWPFRRLTEIGGIRPVSTPGIPLSSSLPCKTYGVGA
FT                   FASVKPDSTAYGGDSTRHPANSTSASHSGGTSGEKRAESKATPLKNSGHLADIHTATST
FT                   SCMPLE"
     atgttgccag gttggcctcg cggacggcgg tggccgtttc gccggctgac agagatcggc        60
     ggcatacgac ccgtctcgac gcccggaatc cccctgtcat catcccttcc atgtaagacc       120
     tacggggtcg gcgccttcgc atctgtaaaa ccggactcga cggcatacgg cggcgattcc       180
     acgcgtcatc cggcaaactc gacttccgct tcgcattcgg gcggcacgtc tggcgaaaag       240
     cgggctgaaa gcaaagcaac gcctctcaag aactccggtc atcttgccga tatccatacg       300
     gccacgtcca cgtcatgcat gccgcttgaa tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page