(data stored in ACNUC7421 zone)

EMBL: CP000271.PE342

CP000271.PE342       Location/Qualifiers
FT   CDS_pept        complement(397427..397717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2683"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2683"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33310"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RH9"
FT                   /protein_id="ABE33310.1"
FT                   /translation="MDNADAALEKMSRLVTANMETVSMLGARAMVLGKFLDAALPQLTT
FT                   SQRAEVALSFRQGIEDAMALMDDVPLHAGYHSALLELTNTILATLAQGSVR"
     ttggacaatg ctgacgcggc gctggagaaa atgagccggc tcgtgaccgc caacatggag        60
     accgtgagca tgcttggggc acgcgcgatg gtgctgggca aatttctcga cgcggcgctg       120
     ccccagctca caacgtcgca gcgcgccgag gttgcgctgt cgttccggca gggtatcgag       180
     gacgcgatgg cgttaatgga cgatgtaccc ttgcatgccg gctatcactc ggccctgctc       240
     gaactcacca ataccatcct tgccacattg gctcagggat ctgtccgcta g                291
//

If you have problems or comments...

PBIL Back to PBIL home page