(data stored in ACNUC7421 zone)

EMBL: CP000271.PE344

CP000271.PE344       Location/Qualifiers
FT   CDS_pept        399817..400260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2681"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33312"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RH7"
FT                   /protein_id="ABE33312.1"
FT                   /translation="MNRLIIYIVVVASFLVFPGTTAAWLPFGNEVTVYMLSCDGEQKSG
FT                   LCHGREKTDIPFTYKVLADQLSVWYWRADDPDEPRRLSFCAIHDMKNWLCQWGSEEIPK
FT                   SRFGMVSGRYAEIATCVTVTSTPLFYQVSRLRWWFVWLREQLS"
     atgaatcggc tgatcattta catcgtagtc gtggcaagct ttctggtttt ccccggcacg        60
     acagcggcgt ggctgccctt cggaaatgaa gttaccgtct atatgttgtc ctgtgacgga       120
     gaacagaaaa gcggcctctg tcatggccgt gaaaagaccg atatcccttt cacctataag       180
     gtgctggccg atcagctttc cgtgtggtac tggcgagcgg acgatccgga tgagccgcgg       240
     cgcctttcat tctgcgccat tcatgacatg aagaactggt tgtgccagtg gggcagcgag       300
     gagattccaa agtcgaggtt cggcatggtg tccggcagat atgcggagat cgcaacctgt       360
     gtgaccgtca catccactcc gcttttttat caggtgtcca ggctgcgctg gtggttcgtc       420
     tggttgcggg agcaactgtc ctga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page