(data stored in ACNUC7421 zone)

EMBL: CP000271.PE347

CP000271.PE347       Location/Qualifiers
FT   CDS_pept        403883..404167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2678"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2678"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33315"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RH4"
FT                   /protein_id="ABE33315.1"
FT                   /translation="MRADQLLPDHADHIDVHGATIRKGTIAAFLANALVWSDAHASEPA
FT                   RAQAAADIVDALPALRASGLFGVLEIRDPELRAWIDAQLAGLPSDEVRS"
     atgcgagccg atcagcttct tcccgaccat gccgatcata tcgacgttca cggcgcgacg        60
     atccgcaagg gcaccatcgc ggcgtttctt gccaatgcgc ttgtctggag cgacgctcat       120
     gcaagcgagc cggcacgcgc gcaggccgcc gccgatattg tcgatgcgct gcccgcgttg       180
     cgcgcgtcag ggcttttcgg ggtgctcgaa attcgcgatc ccgaactgcg agcgtggatc       240
     gatgcgcaac tggccggctt gccatccgac gaggtgcgct catga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page