(data stored in ACNUC7421 zone)

EMBL: CP000271.PE35

CP000271.PE35        Location/Qualifiers
FT   CDS_pept        37540..38193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2993"
FT                   /product="ABC glycine betaine/L-proline transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2993"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33003"
FT                   /db_xref="GOA:Q13SD6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD6"
FT                   /protein_id="ABE33003.1"
FT                   /translation="MTVFDYLSANWPELLQLTAQHVWLVGIAVGCAIFVGVPLGILINW
FT                   HEWLAAPLLSIATVVLTLPSIALFGLMIPVFSRFGQGIGAVPAITAVFLYSLLPIMRNT
FT                   YLALRNVDAGIKEAGIGIGMTVWQRLRLVDLPLAVPVILGGVRTAVVMNIGVMTIAAVI
FT                   GAGGLGTLIIRAIGQSSMMKLLVGAVLVSVLAIVADLLLQALQRLLTPKGVQKT"
     atgactgtat tcgactatct atcggccaac tggcctgaat tactgcaact cacggcacaa        60
     catgtgtggc tggtgggcat tgcggtgggt tgcgcgattt tcgtcggcgt acccctgggt       120
     atcctgatca attggcacga atggctcgcc gcgccgctgc tgagcattgc aacggtggtg       180
     ctgaccttgc cttccatcgc gctgttcggc ttgatgattc cggtgttctc gcgcttcggc       240
     cagggcattg gcgcggtgcc ggcgattacc gccgtgttcc tctactcgct gctgccgatc       300
     atgcgcaaca cctacctcgc gctgcgcaac gtcgacgccg gcatcaagga agcgggcatc       360
     ggcatcggca tgacggtgtg gcaacggctg cgccttgtgg acttgccgct cgccgtgccg       420
     gtgattctcg gcggcgtgcg tactgcggtg gtgatgaaca tcggcgtgat gacgatcgcc       480
     gcggtgatcg gcgccggcgg tctcggcacg ctgatcatcc gcgcgatcgg ccagagcagc       540
     atgatgaaac tgttggtggg cgccgtgctc gtgagcgtgc tcgcgattgt cgcggacctg       600
     ctgctgcaag cgttgcaacg cttgctgacc ccgaagggag tacaaaagac atga             654
//

If you have problems or comments...

PBIL Back to PBIL home page