(data stored in ACNUC7421 zone)

EMBL: CP000271.PE352

CP000271.PE352       Location/Qualifiers
FT   CDS_pept        complement(408855..409277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2673"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2673"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33320"
FT                   /db_xref="GOA:Q13RG9"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RG9"
FT                   /protein_id="ABE33320.1"
FT                   /translation="MCSLLYLRGYPLKFRRRGNPITARQPLSFFNHHRGHQMQQVWLFL
FT                   AGVLLCNSVPHLASGLQGLPFPTPFARPSGVGNSPPLVNVLWGFANLVIGLLIVARHAN
FT                   TSAIGLDAAAGLAGALAIGVFLALHFGKVQRDRLPD"
     atgtgttctc tattatattt gagaggatat cctctcaaat ttcgcagacg cggcaatccg        60
     atcacggccc gtcagccact ttcatttttc aatcaccatc gaggtcatca aatgcagcag       120
     gtctggctgt ttctcgccgg ggtgcttctg tgcaacagcg ttccacacct cgcttccggg       180
     ttgcaagggc ttcccttccc tacgcctttt gcccggccga gcggtgtcgg aaattctccg       240
     ccgttggtca acgtgctctg gggatttgcc aacctcgtca tcgggcttct gatcgtggcg       300
     cgtcatgcaa acacgtcggc gattggcctg gatgcggcag ccggactcgc gggcgccctt       360
     gccatcgggg ttttcctggc gctccatttc ggtaaggtgc aacgagacag gctgccggac       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page