(data stored in ACNUC7421 zone)

EMBL: CP000271.PE358

CP000271.PE358       Location/Qualifiers
FT   CDS_pept        412871..414214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2667"
FT                   /product="Putative chloride-channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2667"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33326"
FT                   /db_xref="GOA:Q13RG3"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RG3"
FT                   /protein_id="ABE33326.1"
FT                   /translation="MCFISLPRGYIPMRIHALADRRTILRIRRLWLHYGIFWLGAVATG
FT                   LVAVMYAKLIDFGYDTFLRYTTSHRWLPLLLTPAVAALGVWITRRWFVGAEGSGIPQVI
FT                   ATLHEGRELGPRLLSMRILIGKIGVSFLSILGGLTIGREGPTIHVGAALMFSLRRFYPA
FT                   RFRSIRGAALERNLALAGAAAGLSAAFNAPLAGVVFAIEELTRSFEQRTSGVLITAIIF
FT                   AGVVSLGLQGNYTYFGTIDIDGHFPDMLAIAAVMLGVVTGVAGGAFCWLLLNTNRWMPA
FT                   RLVVWRKDHPVAFGAACGLVIALIGVAAGGHTFGSGYAEARGMLEGNSQLGASYPILKM
FT                   ASMVGSYLPGAPGGLFAPSLAIGAGIGNALHLVFGQMQLPMLIALGMVGYLAAVTQSPI
FT                   TAFVIVIEMINGHALVLSLMTTALIASQVSRLFAPPLYEALSKRYVAG"
     atgtgcttta tttcgcttcc acgcggctat atcccgatgc gcattcacgc ccttgctgac        60
     cgacgcacga tcctgcgtat cagacgtctc tggttgcact acggcatctt ctggctcggc       120
     gcagtcgcga cggggctcgt cgccgtcatg tacgcgaagc tgatcgattt cggctacgac       180
     acgtttctgc gctatacgac ttcgcaccgt tggctgccgc ttcttcttac accggcggtt       240
     gcggcgctcg gcgtgtggat cacgcggcgc tggtttgtag gcgccgaggg aagcggtatc       300
     ccgcaggtta tcgcaacgct gcacgaaggg cgggaactgg gtccccgcct gctcagcatg       360
     cgtattctga tcggcaagat cggcgtgtcg ttcctgtcga ttctcggcgg cctcaccatt       420
     ggccgcgagg ggccgacaat ccatgtcggt gccgcgctca tgttcagctt gcggcgattt       480
     tatccggcgc gtttccgcag tattcgtggc gcggcgctcg agcgcaatct ggctctggcg       540
     ggcgccgctg cgggactgtc tgcagcattc aacgcgccgc ttgcaggcgt ggttttcgcc       600
     atcgaggaac tgacacgcag tttcgaacag agaaccagcg gcgtcctcat caccgcgatc       660
     atctttgcgg gcgtcgtctc gctcggcttg cagggcaatt acacctactt tggcacgatc       720
     gatatagacg ggcactttcc ggatatgctc gccattgctg ccgttatgct cggggtggtc       780
     acaggcgtcg cgggaggcgc gttctgctgg ctactgttga atacgaaccg ctggatgccg       840
     gcgcgcctcg tggtgtggag aaaagaccac ccggtggcgt tcggcgcagc atgcggcctc       900
     gttatcgcgc tgatcggcgt tgctgccggc ggtcatacct tcggcagtgg ttatgcggaa       960
     gcacgcggga tgctcgaagg taactcgcag cttggcgcga gttatccgat tctgaagatg      1020
     gcgtcgatgg tcggttcgta tttgcccggc gcgcctgggg gactcttcgc gccttcgctg      1080
     gccattggcg caggcatcgg caacgcgctg catctcgtgt tcgggcagat gcagttgccc      1140
     atgctgatcg cgctcggcat ggtgggttat cttgctgcgg tcacgcagag tccaatcacg      1200
     gccttcgtga ttgtgatcga gatgatcaac gggcacgcgc tggtgttgtc gttgatgacg      1260
     acggcgttga tcgccagcca ggtgtcgagg ctattcgctc cgccgctcta tgaagccctg      1320
     tcaaaacgct acgttgccgg ctga                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page