(data stored in SCRATCH zone)

EMBL: CP000271.PE36

CP000271.PE36        Location/Qualifiers
FT   CDS_pept        38190..39392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2992"
FT                   /product="ABC glycine betaine/L-proline transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2992"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33004"
FT                   /db_xref="GOA:Q13SD5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD5"
FT                   /protein_id="ABE33004.1"
FT                   /translation="MIELDKLTKTFTQKDGQQVKAVDSVSLTVGEGEICVFLGPSGCGK
FT                   TTTLKMINRLIAPTSGRVLINGEDTSGLNEVELRRHIGYVIQQIGLFPNMTIEENITVV
FT                   PRLLGWDRKRCRERATELMSMVALEPKQYLKRYPRELSGGQQQRIGVIRALAADPPVLL
FT                   MDEPFGAVDPINRESIQNEFFQMQRQLNKTVIMVSHDIDEAIKLGDRVAVFRRGRLVQY
FT                   DHPDTLLAHPRDEFVGAFVGQDSTLKRLLLVKAGDAATQPGTARAAMPVARAFQMMDDS
FT                   DSRYLTIVDENQQALGYVTRRAARTGEGLCGDHLSTFKATVSADENLRIVLSKMYQFNS
FT                   SWMPVLDGDGRYVGEVTQDSIADYLSSGRSRRQTGQPAIVSPAVAAAEAAAAQVATADH
FT                   A"
     atgatcgaac tcgacaaact gaccaagacg tttacgcaaa aagacggcca gcaggtgaag        60
     gccgtcgact cggtgagcct cacggtgggc gaaggcgaaa tctgcgtatt tctcggcccc       120
     tcgggctgcg gcaagaccac cacgctgaag atgatcaacc gtctgatcgc gccgacgtcg       180
     ggccgcgtgc tgatcaacgg tgaagacacg tcgggtctga acgaagtcga attgcgccgc       240
     cacatcggct acgtgatcca gcagatcggc ctgttcccga atatgacgat cgaagagaac       300
     atcacggtcg tgccgcgcct gctcggctgg gacaggaaac gttgccgcga acgggccacg       360
     gagttgatgt cgatggtcgc gctcgagccg aagcagtatc tgaagcgtta tccgcgtgag       420
     ttgtcgggtg gccagcagca gcgcatcggc gtgattcgcg cgttggccgc ggatccgccg       480
     gtgctgctga tggacgagcc gttcggcgcg gtcgacccga tcaatcgcga gtcgattcag       540
     aacgagttct tccagatgca gcgtcaactg aacaagacgg tgatcatggt gagccacgac       600
     atcgacgagg cgatcaagct cggcgatcgt gtcgccgtgt tccgccgtgg tcgactggtg       660
     caatacgatc atccggatac actgctcgcg catccacgcg acgagttcgt cggcgcgttc       720
     gtcggtcagg acagcacgtt aaagcgcctc ctgctggtga aggccggcga cgccgccacc       780
     cagccgggga ctgcgcgcgc cgctatgccg gtggcgcgtg cgttccagat gatggacgac       840
     agcgatagcc gttatctgac catcgtcgac gagaaccagc aggcgctcgg ctatgtgaca       900
     cgccgcgcgg cgcgcacagg cgaaggcctg tgcggtgacc atctgagcac gttcaaggcg       960
     accgtcagcg cggacgagaa tctgcgcatc gtgctgtcga agatgtatca gttcaactcc      1020
     tcatggatgc cggtgctgga cggcgacggc cgttacgtcg gcgaagtcac gcaggattcg      1080
     attgcggact atctgagctc aggccgttcg cgcaggcaga cggggcagcc tgcgatcgtc      1140
     tcgcccgccg tcgccgcagc ggaggcggcc gctgcgcagg ttgcaacggc tgatcacgcg      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page